BLASTX nr result
ID: Sinomenium21_contig00038896
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00038896 (429 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002447803.1| hypothetical protein SORBIDRAFT_06g016030 [S... 55 8e-06 >ref|XP_002447803.1| hypothetical protein SORBIDRAFT_06g016030 [Sorghum bicolor] gi|241938986|gb|EES12131.1| hypothetical protein SORBIDRAFT_06g016030 [Sorghum bicolor] Length = 1529 Score = 55.5 bits (132), Expect = 8e-06 Identities = 33/85 (38%), Positives = 51/85 (60%), Gaps = 5/85 (5%) Frame = -1 Query: 396 LTRKSLNKSVPASV*DMRHLDFENSL----DRNL-HGPIFCNYFPNFLTSPHVFNASNVI 232 LTRK LN S+ AS+ D R+ F++SL + +L +GP+F N FP+F S N + + Sbjct: 37 LTRKGLNVSILASLRDCRNKRFQDSLLGMVEASLSNGPVFFNTFPDFSVSLSNPNINKAL 96 Query: 231 ELSLCIQGLNLNEGSPNLVIIYRVF 157 L+L G +L GS N+ + YR++ Sbjct: 97 TLNLQTSGFDLEPGSENISVTYRIY 121