BLASTX nr result
ID: Sinomenium21_contig00038882
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00038882 (270 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007039922.1| Cupredoxin superfamily protein isoform 2 [Th... 58 2e-06 ref|XP_007039921.1| Cupredoxin superfamily protein isoform 1 [Th... 58 2e-06 >ref|XP_007039922.1| Cupredoxin superfamily protein isoform 2 [Theobroma cacao] gi|508777167|gb|EOY24423.1| Cupredoxin superfamily protein isoform 2 [Theobroma cacao] Length = 501 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 MAALRFFPLFLIHICLFWTLCFAGDPFVYYDWEVSYIT 3 MA +F LFLIHI L LCFAGDPFV+YD+EVSYIT Sbjct: 1 MALGKFLGLFLIHIALLLGLCFAGDPFVFYDFEVSYIT 38 >ref|XP_007039921.1| Cupredoxin superfamily protein isoform 1 [Theobroma cacao] gi|508777166|gb|EOY24422.1| Cupredoxin superfamily protein isoform 1 [Theobroma cacao] Length = 591 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 MAALRFFPLFLIHICLFWTLCFAGDPFVYYDWEVSYIT 3 MA +F LFLIHI L LCFAGDPFV+YD+EVSYIT Sbjct: 1 MALGKFLGLFLIHIALLLGLCFAGDPFVFYDFEVSYIT 38