BLASTX nr result
ID: Sinomenium21_contig00038612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00038612 (979 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006851829.1| hypothetical protein AMTR_s00041p00059380 [A... 58 7e-06 >ref|XP_006851829.1| hypothetical protein AMTR_s00041p00059380 [Amborella trichopoda] gi|548855412|gb|ERN13296.1| hypothetical protein AMTR_s00041p00059380 [Amborella trichopoda] Length = 1031 Score = 57.8 bits (138), Expect = 7e-06 Identities = 30/62 (48%), Positives = 44/62 (70%) Frame = -2 Query: 975 SLEETKPQEQRKGSVGLAGLKLWGQTAAPISSETQKAIEKLKGYQKELELIQCGIHVART 796 S E+ EQRKGS GLA LKLW + A +SS+TQK ++ +K + E+ELI+ G++ ART Sbjct: 970 SAVESGGTEQRKGS-GLALLKLWSSSLATVSSKTQKVLDTIKRCRMEMELIEFGVNTART 1028 Query: 795 LM 790 ++ Sbjct: 1029 IL 1030