BLASTX nr result
ID: Sinomenium21_contig00038387
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00038387 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19296.3| unnamed protein product [Vitis vinifera] 60 2e-07 ref|XP_006844143.1| hypothetical protein AMTR_s00006p00259390 [A... 60 4e-07 ref|XP_007018286.1| Transcription initiation factor IIA gamma ch... 60 4e-07 gb|AFW82923.1| hypothetical protein ZEAMMB73_776594 [Zea mays] 60 4e-07 gb|AFW82922.1| hypothetical protein ZEAMMB73_776594 [Zea mays] 60 4e-07 gb|AFW82921.1| hypothetical protein ZEAMMB73_776594 [Zea mays] 60 4e-07 gb|ACG32599.1| transcription initiation factor IIA gamma chain [... 60 4e-07 ref|NP_001152705.1| LOC100286346 [Zea mays] gi|195611888|gb|ACG2... 60 4e-07 gb|ACZ58035.1| TFIIA small subunity [Saccharum hybrid cultivar S... 59 9e-07 ref|XP_006433782.1| hypothetical protein CICLE_v10002917mg [Citr... 58 1e-06 ref|XP_004287436.1| PREDICTED: transcription initiation factor I... 58 1e-06 ref|XP_007225949.1| hypothetical protein PRUPE_ppa012329mg [Prun... 58 1e-06 ref|XP_004138656.1| PREDICTED: transcription initiation factor I... 58 1e-06 ref|XP_004138655.1| PREDICTED: transcription initiation factor I... 58 1e-06 gb|AFK36634.1| unknown [Lotus japonicus] 58 1e-06 ref|XP_003519205.1| PREDICTED: transcription initiation factor I... 58 1e-06 ref|XP_003544835.1| PREDICTED: transcription initiation factor I... 58 1e-06 ref|XP_003620976.1| Transcription initiation factor IIA subunit ... 58 1e-06 ref|XP_002285630.1| PREDICTED: transcription initiation factor I... 58 1e-06 ref|NP_001054426.1| Os05g0107700 [Oryza sativa Japonica Group] g... 58 2e-06 >emb|CBI19296.3| unnamed protein product [Vitis vinifera] Length = 163 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = -1 Query: 121 FLFF*SLTAFTQMATFELYRRSTIGMCLTETLDEMVSNGT 2 FL S + +MATFELYRRSTIGMCLTETLDEMV NGT Sbjct: 46 FLSLPSPSIIVRMATFELYRRSTIGMCLTETLDEMVQNGT 85 >ref|XP_006844143.1| hypothetical protein AMTR_s00006p00259390 [Amborella trichopoda] gi|548846542|gb|ERN05818.1| hypothetical protein AMTR_s00006p00259390 [Amborella trichopoda] Length = 106 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 85 MATFELYRRSTIGMCLTETLDEMVSNGT 2 MATFELYRRSTIGMCLTETLDEMVSNGT Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVSNGT 28 >ref|XP_007018286.1| Transcription initiation factor IIA gamma chain / TFIIA-gamma (TFIIA-S) isoform 1 [Theobroma cacao] gi|590596254|ref|XP_007018287.1| Transcription initiation factor IIA gamma chain / TFIIA-gamma (TFIIA-S) isoform 1 [Theobroma cacao] gi|508723614|gb|EOY15511.1| Transcription initiation factor IIA gamma chain / TFIIA-gamma (TFIIA-S) isoform 1 [Theobroma cacao] gi|508723615|gb|EOY15512.1| Transcription initiation factor IIA gamma chain / TFIIA-gamma (TFIIA-S) isoform 1 [Theobroma cacao] Length = 106 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 85 MATFELYRRSTIGMCLTETLDEMVSNGT 2 MATFELYRRSTIGMCLTETLDEMVSNGT Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVSNGT 28 >gb|AFW82923.1| hypothetical protein ZEAMMB73_776594 [Zea mays] Length = 74 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 85 MATFELYRRSTIGMCLTETLDEMVSNGT 2 MATFELYRRSTIGMCLTETLDEMVSNGT Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVSNGT 28 >gb|AFW82922.1| hypothetical protein ZEAMMB73_776594 [Zea mays] Length = 78 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 85 MATFELYRRSTIGMCLTETLDEMVSNGT 2 MATFELYRRSTIGMCLTETLDEMVSNGT Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVSNGT 28 >gb|AFW82921.1| hypothetical protein ZEAMMB73_776594 [Zea mays] Length = 62 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 85 MATFELYRRSTIGMCLTETLDEMVSNGT 2 MATFELYRRSTIGMCLTETLDEMVSNGT Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVSNGT 28 >gb|ACG32599.1| transcription initiation factor IIA gamma chain [Zea mays] Length = 106 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 85 MATFELYRRSTIGMCLTETLDEMVSNGT 2 MATFELYRRSTIGMCLTETLDEMVSNGT Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVSNGT 28 >ref|NP_001152705.1| LOC100286346 [Zea mays] gi|195611888|gb|ACG27774.1| transcription initiation factor IIA gamma chain [Zea mays] gi|195659197|gb|ACG49066.1| transcription initiation factor IIA gamma chain [Zea mays] gi|219887343|gb|ACL54046.1| unknown [Zea mays] gi|413950271|gb|AFW82920.1| transcription initiation factor IIA gamma chain [Zea mays] Length = 106 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 85 MATFELYRRSTIGMCLTETLDEMVSNGT 2 MATFELYRRSTIGMCLTETLDEMVSNGT Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVSNGT 28 >gb|ACZ58035.1| TFIIA small subunity [Saccharum hybrid cultivar SP80-3280] Length = 106 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -1 Query: 85 MATFELYRRSTIGMCLTETLDEMVSNGT 2 MATFELYRRSTIGMCLTETLDEMV+NGT Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVNNGT 28 >ref|XP_006433782.1| hypothetical protein CICLE_v10002917mg [Citrus clementina] gi|567882449|ref|XP_006433783.1| hypothetical protein CICLE_v10002917mg [Citrus clementina] gi|568836795|ref|XP_006472418.1| PREDICTED: transcription initiation factor IIA subunit 2-like [Citrus sinensis] gi|557535904|gb|ESR47022.1| hypothetical protein CICLE_v10002917mg [Citrus clementina] gi|557535905|gb|ESR47023.1| hypothetical protein CICLE_v10002917mg [Citrus clementina] Length = 106 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -1 Query: 85 MATFELYRRSTIGMCLTETLDEMVSNGT 2 MATFELYRRSTIGMCLTETLDEMV NGT Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVQNGT 28 >ref|XP_004287436.1| PREDICTED: transcription initiation factor IIA subunit 2-like [Fragaria vesca subsp. vesca] gi|502110229|ref|XP_004493830.1| PREDICTED: transcription initiation factor IIA subunit 2-like isoform X1 [Cicer arietinum] gi|502110233|ref|XP_004493831.1| PREDICTED: transcription initiation factor IIA subunit 2-like isoform X2 [Cicer arietinum] Length = 106 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -1 Query: 85 MATFELYRRSTIGMCLTETLDEMVSNGT 2 MATFELYRRSTIGMCLTETLDEMV NGT Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVQNGT 28 >ref|XP_007225949.1| hypothetical protein PRUPE_ppa012329mg [Prunus persica] gi|462422885|gb|EMJ27148.1| hypothetical protein PRUPE_ppa012329mg [Prunus persica] Length = 173 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -1 Query: 85 MATFELYRRSTIGMCLTETLDEMVSNGT 2 MATFELYRRSTIGMCLTETLDEMV NGT Sbjct: 68 MATFELYRRSTIGMCLTETLDEMVQNGT 95 >ref|XP_004138656.1| PREDICTED: transcription initiation factor IIA subunit 2-like [Cucumis sativus] Length = 106 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -1 Query: 85 MATFELYRRSTIGMCLTETLDEMVSNGT 2 MATFELYRRSTIGMCLTETLDEMV NGT Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVQNGT 28 >ref|XP_004138655.1| PREDICTED: transcription initiation factor IIA subunit 2-like [Cucumis sativus] gi|449490144|ref|XP_004158520.1| PREDICTED: transcription initiation factor IIA subunit 2-like [Cucumis sativus] Length = 106 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -1 Query: 85 MATFELYRRSTIGMCLTETLDEMVSNGT 2 MATFELYRRSTIGMCLTETLDEMV NGT Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVQNGT 28 >gb|AFK36634.1| unknown [Lotus japonicus] Length = 106 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -1 Query: 85 MATFELYRRSTIGMCLTETLDEMVSNGT 2 MATFELYRRSTIGMCLTETLDEMV NGT Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVQNGT 28 >ref|XP_003519205.1| PREDICTED: transcription initiation factor IIA subunit 2-like [Glycine max] gi|593488837|ref|XP_007141286.1| hypothetical protein PHAVU_008G183300g [Phaseolus vulgaris] gi|593488839|ref|XP_007141287.1| hypothetical protein PHAVU_008G183300g [Phaseolus vulgaris] gi|561014419|gb|ESW13280.1| hypothetical protein PHAVU_008G183300g [Phaseolus vulgaris] gi|561014420|gb|ESW13281.1| hypothetical protein PHAVU_008G183300g [Phaseolus vulgaris] Length = 106 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -1 Query: 85 MATFELYRRSTIGMCLTETLDEMVSNGT 2 MATFELYRRSTIGMCLTETLDEMV NGT Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVQNGT 28 >ref|XP_003544835.1| PREDICTED: transcription initiation factor IIA subunit 2-like [Glycine max] Length = 106 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -1 Query: 85 MATFELYRRSTIGMCLTETLDEMVSNGT 2 MATFELYRRSTIGMCLTETLDEMV NGT Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVQNGT 28 >ref|XP_003620976.1| Transcription initiation factor IIA subunit [Medicago truncatula] gi|217071430|gb|ACJ84075.1| unknown [Medicago truncatula] gi|355495991|gb|AES77194.1| Transcription initiation factor IIA subunit [Medicago truncatula] gi|388521381|gb|AFK48752.1| unknown [Medicago truncatula] Length = 106 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -1 Query: 85 MATFELYRRSTIGMCLTETLDEMVSNGT 2 MATFELYRRSTIGMCLTETLDEMV NGT Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVQNGT 28 >ref|XP_002285630.1| PREDICTED: transcription initiation factor IIA subunit 2 isoform 1 [Vitis vinifera] gi|359492969|ref|XP_003634490.1| PREDICTED: transcription initiation factor IIA subunit 2 isoform 2 [Vitis vinifera] gi|147775910|emb|CAN60284.1| hypothetical protein VITISV_015528 [Vitis vinifera] Length = 106 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -1 Query: 85 MATFELYRRSTIGMCLTETLDEMVSNGT 2 MATFELYRRSTIGMCLTETLDEMV NGT Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVQNGT 28 >ref|NP_001054426.1| Os05g0107700 [Oryza sativa Japonica Group] gi|122169632|sp|Q0DLD3.1|T2AG_ORYSJ RecName: Full=Transcription initiation factor IIA subunit 2; AltName: Full=General transcription factor IIA subunit 2; AltName: Full=Transcription initiation factor IIA gamma chain; Short=TFIIA-gamma gi|158513184|sp|A2XZI2.2|T2AG_ORYSI RecName: Full=Transcription initiation factor IIA subunit 2; AltName: Full=General transcription factor IIA subunit 2; AltName: Full=Transcription initiation factor IIA gamma chain; Short=TFIIA-gamma gi|14719311|gb|AAK73129.1|AC079022_2 putative transcription factor IIA small subunit [Oryza sativa] gi|28195115|gb|AAO33769.1| transcription factor IIA small subunit [Oryza sativa Indica Group] gi|52353565|gb|AAU44131.1| putative transcription initiation factor IIA gamma chain [Oryza sativa Japonica Group] gi|55585041|gb|AAV53716.1| transcription factor IIA gamma subunit [Oryza sativa Indica Group] gi|113577977|dbj|BAF16340.1| Os05g0107700 [Oryza sativa Japonica Group] gi|215694411|dbj|BAG89404.1| unnamed protein product [Oryza sativa Japonica Group] gi|218195944|gb|EEC78371.1| hypothetical protein OsI_18140 [Oryza sativa Indica Group] gi|222629915|gb|EEE62047.1| hypothetical protein OsJ_16831 [Oryza sativa Japonica Group] gi|347737139|gb|AEP20535.1| transcription factor [Oryza sativa Japonica Group] Length = 106 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -1 Query: 85 MATFELYRRSTIGMCLTETLDEMVSNGT 2 MATFELYRRSTIGMCLTETLDEMVS+GT Sbjct: 1 MATFELYRRSTIGMCLTETLDEMVSSGT 28