BLASTX nr result
ID: Sinomenium21_contig00038265
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00038265 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007157135.1| hypothetical protein PHAVU_002G045700g [Phas... 55 8e-06 >ref|XP_007157135.1| hypothetical protein PHAVU_002G045700g [Phaseolus vulgaris] gi|561030550|gb|ESW29129.1| hypothetical protein PHAVU_002G045700g [Phaseolus vulgaris] Length = 1287 Score = 55.5 bits (132), Expect = 8e-06 Identities = 41/103 (39%), Positives = 57/103 (55%), Gaps = 5/103 (4%) Frame = +1 Query: 1 KQYEDDLIDYKNR-ISSSFTPIPEVVLSQLTRQTSKKIERE-KTMKQKADREHKKAKTSH 174 KQ DD + K + SSSF PI + VLSQLTR+T KK+E+E K K+K D E + K Sbjct: 441 KQLNDDAKEVKAKGDSSSFAPIADEVLSQLTRKTRKKMEKELKKKKKKYDSESRNEKEPQ 500 Query: 175 KKLQKELVKVRMGRT---VNGKETDSFTMKDDKSLKFRIKGNT 294 +K + K M T N ++ SF + KS+K ++ NT Sbjct: 501 RK-RSASNKCDMNSTDSDSNEEKLSSFIKQGSKSMKSKMSENT 542