BLASTX nr result
ID: Sinomenium21_contig00038033
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00038033 (574 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007212580.1| hypothetical protein PRUPE_ppa015871mg, part... 60 4e-07 emb|CAN68838.1| hypothetical protein VITISV_030956 [Vitis vinifera] 56 8e-06 >ref|XP_007212580.1| hypothetical protein PRUPE_ppa015871mg, partial [Prunus persica] gi|462408445|gb|EMJ13779.1| hypothetical protein PRUPE_ppa015871mg, partial [Prunus persica] Length = 1499 Score = 60.1 bits (144), Expect = 4e-07 Identities = 36/84 (42%), Positives = 49/84 (58%) Frame = +2 Query: 233 LRQERWQKGVDKV*MKILS*NIQGCGSSKKGEPLKKCLAIKEVLRRSKPDLIVWQEIKKE 412 L R +KG+ MKI+S NI+G GS +K L +KE LRR KPD+++ E KKE Sbjct: 309 LAHRRHEKGLFLSLMKIISWNIRGLGSRRKR------LLVKEQLRRLKPDIVILLETKKE 362 Query: 413 EVNRRLICQIWGLRGLRSGWCFLP 484 V+R+L+ +WG R W F P Sbjct: 363 IVDRQLVAGVWGSR--FKEWVFSP 384 >emb|CAN68838.1| hypothetical protein VITISV_030956 [Vitis vinifera] Length = 1881 Score = 55.8 bits (133), Expect = 8e-06 Identities = 31/75 (41%), Positives = 42/75 (56%) Frame = +2 Query: 260 VDKV*MKILS*NIQGCGSSKKGEPLKKCLAIKEVLRRSKPDLIVWQEIKKEEVNRRLICQ 439 V K MKI+S N +G GS KK +K+ LR KPD++++QE KKEE +RR + Sbjct: 825 VTKFHMKIISWNTRGLGSKKKRR------VVKDFLRSEKPDVVMFQETKKEECDRRFVGS 878 Query: 440 IWGLRGLRSGWCFLP 484 +W R W LP Sbjct: 879 VWTAR--NKDWAALP 891