BLASTX nr result
ID: Sinomenium21_contig00037979
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00037979 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABO26299.1| polyprotein [Nicotiana tabacum] 56 6e-06 >gb|ABO26299.1| polyprotein [Nicotiana tabacum] Length = 57 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/40 (57%), Positives = 34/40 (85%) Frame = +2 Query: 2 EEGEIFLQKISTHDNPADMLTKTILAIKLKHCLNLINILQ 121 EEG + ++KI T +NPADMLTK ++A+K +HCL+LINI++ Sbjct: 17 EEGGVTVKKIHTTENPADMLTKVVIAVKFQHCLDLINIVE 56