BLASTX nr result
ID: Sinomenium21_contig00037960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00037960 (690 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA65979.1| hypothetical protein [Beta vulgaris subsp. vulga... 54 3e-06 >emb|CCA65979.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1110 Score = 53.5 bits (127), Expect(2) = 3e-06 Identities = 27/75 (36%), Positives = 44/75 (58%), Gaps = 1/75 (1%) Frame = +3 Query: 357 FVRSRNILGDILTCHEVVRGFG*K-LLVSCIAQGGYPQGYDSID*AFLKGVLGRMTIPKR 533 F+ R+I +IL E++RG+ K + CI + + YDS++ +FL+ +L P R Sbjct: 550 FIPGRHIADNILLASELIRGYTRKHMSPRCIMKVDIRKAYDSVEWSFLETLLYEFGFPSR 609 Query: 534 FVDWVAECISSTSLS 578 FV W+ EC+S+ S S Sbjct: 610 FVGWIMECVSTVSYS 624 Score = 23.9 bits (50), Expect(2) = 3e-06 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 607 RGFRQGDSFALYLFTAAMEPL 669 +G RQGD + +LF ME L Sbjct: 639 KGLRQGDPMSPFLFALCMEYL 659