BLASTX nr result
ID: Sinomenium21_contig00037683
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00037683 (258 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285409.1| PREDICTED: uncharacterized protein LOC100262... 60 4e-07 >ref|XP_002285409.1| PREDICTED: uncharacterized protein LOC100262987 [Vitis vinifera] gi|297738997|emb|CBI28242.3| unnamed protein product [Vitis vinifera] Length = 281 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/47 (59%), Positives = 34/47 (72%) Frame = -2 Query: 257 QNIKHIAYRNKLIGDVAEKIVEDWNAQKKVFLEQTRSAQRPNEERKQ 117 QNIKHI+ KLIGDV K E+WNAQK+VF ++T QRP EE +Q Sbjct: 215 QNIKHISEDKKLIGDVVNKTAENWNAQKEVFYQKTGLNQRPAEEHRQ 261