BLASTX nr result
ID: Sinomenium21_contig00037644
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00037644 (496 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB88692.1| hypothetical protein L484_015377 [Morus notabilis] 58 2e-06 >gb|EXB88692.1| hypothetical protein L484_015377 [Morus notabilis] Length = 287 Score = 57.8 bits (138), Expect = 2e-06 Identities = 38/94 (40%), Positives = 48/94 (51%), Gaps = 10/94 (10%) Frame = +1 Query: 10 ETTSPVTRPEKTGFWSGFREALRLGCRENRAVEIEEQS--AASPPCKSEST---GRRRPS 174 E P+ R +KTGF+S FR R GCRE A S + SP + T R P Sbjct: 188 EKQKPIERRKKTGFFSSFRAIFRTGCREKSAQTSARHSEWSESPLRECARTVVRDMRAPH 247 Query: 175 SS-----EAAAEPPGLDGINRFASGRWSDSSAGD 261 S +PPGL G+++FASGR S+S AGD Sbjct: 248 SDSLPRRSVEIDPPGLGGLHKFASGRRSESWAGD 281