BLASTX nr result
ID: Sinomenium21_contig00037613
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00037613 (327 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272822.2| PREDICTED: shugoshin-1-like [Vitis vinifera]... 61 1e-07 >ref|XP_002272822.2| PREDICTED: shugoshin-1-like [Vitis vinifera] gi|296085974|emb|CBI31415.3| unnamed protein product [Vitis vinifera] Length = 317 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/48 (58%), Positives = 35/48 (72%) Frame = -3 Query: 322 EEGKGTSSLSCETPALRRSSIGRPARKATEKVQSYKELSVNAKMRRSD 179 ++ G +L TP RRSSIGRP R+A EKVQSYKE+ +N KMRRS+ Sbjct: 270 KKANGDGALEVATPEFRRSSIGRPLRRAAEKVQSYKEIPINVKMRRSE 317