BLASTX nr result
ID: Sinomenium21_contig00037508
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00037508 (455 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC41989.1| hypothetical protein L484_000662 [Morus notabilis] 57 2e-06 ref|XP_007017233.1| Polyketide cyclase / dehydrase and lipid tra... 57 2e-06 >gb|EXC41989.1| hypothetical protein L484_000662 [Morus notabilis] Length = 210 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 433 LVSRLVASFSDRCRLIYGPGVQVLENSYGE 344 +VSRLV SFS+RCRL+YGPGVQVLENSYG+ Sbjct: 179 VVSRLVGSFSERCRLVYGPGVQVLENSYGQ 208 >ref|XP_007017233.1| Polyketide cyclase / dehydrase and lipid transport protein [Theobroma cacao] gi|508722561|gb|EOY14458.1| Polyketide cyclase / dehydrase and lipid transport protein [Theobroma cacao] Length = 255 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 433 LVSRLVASFSDRCRLIYGPGVQVLENSYGEQ 341 +VSRLV+SFS+RCRLIYGPGV VLENSYGE+ Sbjct: 224 VVSRLVSSFSERCRLIYGPGVPVLENSYGER 254