BLASTX nr result
ID: Sinomenium21_contig00037460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00037460 (362 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AES12473.1| C2H2-type zinc finger protein 1 [Populus trichoca... 56 6e-06 >gb|AES12473.1| C2H2-type zinc finger protein 1 [Populus trichocarpa] Length = 179 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = +3 Query: 87 VPVLKSSSSRRVLCLDLNLTPPENDLDIPIGTGFQEKNTPPMIHCF 224 VPV+K S+SRRVLCLDLNLTP END+++ F+ T PM++CF Sbjct: 138 VPVVKRSNSRRVLCLDLNLTPYENDMEL-----FKLGTTAPMVNCF 178