BLASTX nr result
ID: Sinomenium21_contig00037211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00037211 (521 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABG35770.1| NOX1 [Striga asiatica] 57 4e-06 gb|EYU36233.1| hypothetical protein MIMGU_mgv1a023588mg [Mimulus... 55 8e-06 >gb|ABG35770.1| NOX1 [Striga asiatica] Length = 812 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 15 IRTHFARPNWRKVFTHLASVHTSSRIGKQY 104 IRTHFARPNWRKVFTHL SVH S+RIG Y Sbjct: 751 IRTHFARPNWRKVFTHLTSVHPSTRIGVFY 780 >gb|EYU36233.1| hypothetical protein MIMGU_mgv1a023588mg [Mimulus guttatus] Length = 819 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 15 IRTHFARPNWRKVFTHLASVHTSSRIGKQY 104 IRTHFARPNWRKVF HLASVH S+RIG Y Sbjct: 758 IRTHFARPNWRKVFGHLASVHPSTRIGVFY 787