BLASTX nr result
ID: Sinomenium21_contig00037001
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00037001 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006383007.1| hypothetical protein POPTR_0005s10660g [Popu... 56 4e-06 ref|XP_003629198.1| hypothetical protein MTR_8g074450 [Medicago ... 56 4e-06 >ref|XP_006383007.1| hypothetical protein POPTR_0005s10660g [Populus trichocarpa] gi|550338582|gb|ERP60804.1| hypothetical protein POPTR_0005s10660g [Populus trichocarpa] Length = 285 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +2 Query: 221 YHARSISFPSRSHPDSLRVEEELNNLKAWEIS 316 YH RSIS PSRSHP + R+EEELN LKAWE+S Sbjct: 5 YHVRSISLPSRSHPTTQRIEEELNKLKAWEVS 36 >ref|XP_003629198.1| hypothetical protein MTR_8g074450 [Medicago truncatula] gi|355523220|gb|AET03674.1| hypothetical protein MTR_8g074450 [Medicago truncatula] Length = 290 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = +2 Query: 215 NPYHARSISFPSRSHPDSLRVEEELNNLKAWE 310 N YH RSIS PSRSHP ++RVEEELN LK WE Sbjct: 3 NKYHVRSISLPSRSHPSTIRVEEELNKLKTWE 34