BLASTX nr result
ID: Sinomenium21_contig00036724
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00036724 (253 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006483303.1| PREDICTED: carbon catabolite repressor prote... 153 2e-35 ref|XP_006450507.1| hypothetical protein CICLE_v10007580mg [Citr... 153 2e-35 ref|XP_002282223.2| PREDICTED: carbon catabolite repressor prote... 152 5e-35 ref|XP_002324275.2| hypothetical protein POPTR_0018s01290g [Popu... 152 6e-35 ref|XP_004293013.1| PREDICTED: carbon catabolite repressor prote... 149 3e-34 ref|XP_003545500.1| PREDICTED: carbon catabolite repressor prote... 149 3e-34 ref|XP_002514362.1| conserved hypothetical protein [Ricinus comm... 146 3e-33 ref|XP_004162062.1| PREDICTED: carbon catabolite repressor prote... 145 7e-33 ref|XP_004136470.1| PREDICTED: carbon catabolite repressor prote... 145 7e-33 ref|XP_007225253.1| hypothetical protein PRUPE_ppa001585mg [Prun... 144 2e-32 ref|XP_006287178.1| hypothetical protein CARUB_v10000347mg [Caps... 143 3e-32 ref|XP_004498648.1| PREDICTED: LOW QUALITY PROTEIN: carbon catab... 142 4e-32 gb|EYU21940.1| hypothetical protein MIMGU_mgv1a002905mg [Mimulus... 142 6e-32 ref|XP_007161236.1| hypothetical protein PHAVU_001G053400g [Phas... 140 1e-31 ref|XP_002871471.1| endonuclease/exonuclease/phosphatase family ... 140 2e-31 ref|XP_006854929.1| hypothetical protein AMTR_s00052p00118920, p... 139 4e-31 ref|XP_003588706.1| Carbon catabolite repressor protein-like pro... 139 4e-31 gb|EXB94139.1| hypothetical protein L484_004664 [Morus notabilis] 139 5e-31 ref|XP_006399637.1| hypothetical protein EUTSA_v10012752mg [Eutr... 139 5e-31 ref|XP_004245215.1| PREDICTED: carbon catabolite repressor prote... 139 5e-31 >ref|XP_006483303.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6-like [Citrus sinensis] Length = 732 Score = 153 bits (387), Expect = 2e-35 Identities = 67/83 (80%), Positives = 74/83 (89%) Frame = -3 Query: 251 DYLAVKHRRELYYHIPRHILDWEWRKRKIVFELGLWSADIMCFQEVDRFQDLEDELKHHG 72 DYLA+ HR +LY+HIPRH+LDWEWRKR I+FELGLWSADIMCFQEVDRFQDLE ELK G Sbjct: 160 DYLALSHRSKLYFHIPRHLLDWEWRKRSILFELGLWSADIMCFQEVDRFQDLEVELKFRG 219 Query: 71 YSGIWKMRTGIPIDGCATFWRAA 3 Y+GIWKMRTG IDGCA FWRA+ Sbjct: 220 YTGIWKMRTGNAIDGCAIFWRAS 242 >ref|XP_006450507.1| hypothetical protein CICLE_v10007580mg [Citrus clementina] gi|557553733|gb|ESR63747.1| hypothetical protein CICLE_v10007580mg [Citrus clementina] Length = 732 Score = 153 bits (387), Expect = 2e-35 Identities = 67/83 (80%), Positives = 74/83 (89%) Frame = -3 Query: 251 DYLAVKHRRELYYHIPRHILDWEWRKRKIVFELGLWSADIMCFQEVDRFQDLEDELKHHG 72 DYLA+ HR +LY+HIPRH+LDWEWRKR I+FELGLWSADIMCFQEVDRFQDLE ELK G Sbjct: 160 DYLALSHRSKLYFHIPRHLLDWEWRKRSILFELGLWSADIMCFQEVDRFQDLEVELKFRG 219 Query: 71 YSGIWKMRTGIPIDGCATFWRAA 3 Y+GIWKMRTG IDGCA FWRA+ Sbjct: 220 YTGIWKMRTGNAIDGCAIFWRAS 242 >ref|XP_002282223.2| PREDICTED: carbon catabolite repressor protein 4 homolog 6-like [Vitis vinifera] gi|296081966|emb|CBI20971.3| unnamed protein product [Vitis vinifera] Length = 786 Score = 152 bits (384), Expect = 5e-35 Identities = 65/83 (78%), Positives = 73/83 (87%) Frame = -3 Query: 251 DYLAVKHRRELYYHIPRHILDWEWRKRKIVFELGLWSADIMCFQEVDRFQDLEDELKHHG 72 DYLAV R LY+HIPRH+LDWEWRKR I+FELGLWSAD+MCFQEVDRF DLE+ELK G Sbjct: 174 DYLAVNQRSRLYFHIPRHMLDWEWRKRNIIFELGLWSADVMCFQEVDRFGDLEEELKLRG 233 Query: 71 YSGIWKMRTGIPIDGCATFWRAA 3 Y+GIWKMRTG P+DGCA FWRA+ Sbjct: 234 YTGIWKMRTGDPVDGCAIFWRAS 256 >ref|XP_002324275.2| hypothetical protein POPTR_0018s01290g [Populus trichocarpa] gi|550317779|gb|EEF02840.2| hypothetical protein POPTR_0018s01290g [Populus trichocarpa] Length = 507 Score = 152 bits (383), Expect = 6e-35 Identities = 66/83 (79%), Positives = 72/83 (86%) Frame = -3 Query: 251 DYLAVKHRRELYYHIPRHILDWEWRKRKIVFELGLWSADIMCFQEVDRFQDLEDELKHHG 72 DYLA+ HR +LYYHIPRH+LDWEWRKR I+FELGLWSADIMCFQEVDRF DLE+ LK G Sbjct: 154 DYLAINHRSKLYYHIPRHMLDWEWRKRSIIFELGLWSADIMCFQEVDRFGDLEEVLKVRG 213 Query: 71 YSGIWKMRTGIPIDGCATFWRAA 3 YSGIWKMRTG IDGCA FWR + Sbjct: 214 YSGIWKMRTGNAIDGCAVFWRTS 236 >ref|XP_004293013.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6-like [Fragaria vesca subsp. vesca] Length = 804 Score = 149 bits (377), Expect = 3e-34 Identities = 63/83 (75%), Positives = 75/83 (90%) Frame = -3 Query: 251 DYLAVKHRRELYYHIPRHILDWEWRKRKIVFELGLWSADIMCFQEVDRFQDLEDELKHHG 72 DYLA HR +LYYHIPRH+LDW+WRK+ +VFELGLWSADIMCFQEVDRFQ+L+DELK G Sbjct: 152 DYLANDHRGKLYYHIPRHMLDWQWRKKNLVFELGLWSADIMCFQEVDRFQELQDELKPRG 211 Query: 71 YSGIWKMRTGIPIDGCATFWRAA 3 YSG++KMRTG P+DGCA FWR++ Sbjct: 212 YSGVYKMRTGNPLDGCAVFWRSS 234 >ref|XP_003545500.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6-like [Glycine max] Length = 852 Score = 149 bits (377), Expect = 3e-34 Identities = 63/81 (77%), Positives = 72/81 (88%) Frame = -3 Query: 251 DYLAVKHRRELYYHIPRHILDWEWRKRKIVFELGLWSADIMCFQEVDRFQDLEDELKHHG 72 DYLA+ HR +LY+HIPRHILDW+WRKR I+FELGLWSADI+C QEVDRF +LE+ELK G Sbjct: 169 DYLALDHRTKLYFHIPRHILDWQWRKRSIIFELGLWSADILCLQEVDRFHELEEELKPKG 228 Query: 71 YSGIWKMRTGIPIDGCATFWR 9 YSGIWKMRTG P+DGCA FWR Sbjct: 229 YSGIWKMRTGNPVDGCAIFWR 249 >ref|XP_002514362.1| conserved hypothetical protein [Ricinus communis] gi|223546818|gb|EEF48316.1| conserved hypothetical protein [Ricinus communis] Length = 809 Score = 146 bits (369), Expect = 3e-33 Identities = 63/83 (75%), Positives = 71/83 (85%) Frame = -3 Query: 251 DYLAVKHRRELYYHIPRHILDWEWRKRKIVFELGLWSADIMCFQEVDRFQDLEDELKHHG 72 DYLA+ H R+LY+HIPRH+LDWEWR R I+FEL LWSADIMCFQEVDRFQDL D+LK G Sbjct: 143 DYLAINHWRKLYFHIPRHMLDWEWRMRSILFELRLWSADIMCFQEVDRFQDLADQLKPRG 202 Query: 71 YSGIWKMRTGIPIDGCATFWRAA 3 YSGIWKMRTG +DGCA FWR + Sbjct: 203 YSGIWKMRTGNAVDGCAIFWRTS 225 >ref|XP_004162062.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6-like [Cucumis sativus] Length = 837 Score = 145 bits (365), Expect = 7e-33 Identities = 60/83 (72%), Positives = 72/83 (86%) Frame = -3 Query: 251 DYLAVKHRRELYYHIPRHILDWEWRKRKIVFELGLWSADIMCFQEVDRFQDLEDELKHHG 72 DYLA+ H+++LY+HIP ++LDWEWRK I+FELGLWS DIMCFQEVDRF DLE+ LK G Sbjct: 186 DYLAMDHKQKLYHHIPHYMLDWEWRKNHILFELGLWSTDIMCFQEVDRFHDLEEALKDRG 245 Query: 71 YSGIWKMRTGIPIDGCATFWRAA 3 +SGIWKMRTGIP+DGCA FWR + Sbjct: 246 FSGIWKMRTGIPVDGCAIFWRVS 268 >ref|XP_004136470.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6-like [Cucumis sativus] Length = 871 Score = 145 bits (365), Expect = 7e-33 Identities = 60/83 (72%), Positives = 72/83 (86%) Frame = -3 Query: 251 DYLAVKHRRELYYHIPRHILDWEWRKRKIVFELGLWSADIMCFQEVDRFQDLEDELKHHG 72 DYLA+ H+++LY+HIP ++LDWEWRK I+FELGLWS DIMCFQEVDRF DLE+ LK G Sbjct: 186 DYLAMDHKQKLYHHIPHYMLDWEWRKNHILFELGLWSTDIMCFQEVDRFHDLEEALKDRG 245 Query: 71 YSGIWKMRTGIPIDGCATFWRAA 3 +SGIWKMRTGIP+DGCA FWR + Sbjct: 246 FSGIWKMRTGIPVDGCAIFWRVS 268 >ref|XP_007225253.1| hypothetical protein PRUPE_ppa001585mg [Prunus persica] gi|462422189|gb|EMJ26452.1| hypothetical protein PRUPE_ppa001585mg [Prunus persica] Length = 797 Score = 144 bits (362), Expect = 2e-32 Identities = 58/83 (69%), Positives = 74/83 (89%) Frame = -3 Query: 251 DYLAVKHRRELYYHIPRHILDWEWRKRKIVFELGLWSADIMCFQEVDRFQDLEDELKHHG 72 D LA +HR +LY+HIP H++DW+WRK+ ++FELGLWSADIMCFQEVD+FQD+E+ELK G Sbjct: 119 DSLAHEHRSKLYFHIPHHMMDWQWRKKNLIFELGLWSADIMCFQEVDKFQDIEEELKLKG 178 Query: 71 YSGIWKMRTGIPIDGCATFWRAA 3 Y+GIWKMRTG P+DGCA FWR++ Sbjct: 179 YNGIWKMRTGNPVDGCAIFWRSS 201 >ref|XP_006287178.1| hypothetical protein CARUB_v10000347mg [Capsella rubella] gi|565458359|ref|XP_006287179.1| hypothetical protein CARUB_v10000347mg [Capsella rubella] gi|482555884|gb|EOA20076.1| hypothetical protein CARUB_v10000347mg [Capsella rubella] gi|482555885|gb|EOA20077.1| hypothetical protein CARUB_v10000347mg [Capsella rubella] Length = 705 Score = 143 bits (360), Expect = 3e-32 Identities = 61/82 (74%), Positives = 70/82 (85%) Frame = -3 Query: 251 DYLAVKHRRELYYHIPRHILDWEWRKRKIVFELGLWSADIMCFQEVDRFQDLEDELKHHG 72 DYLA H R LY+HIPR++L W WRKRK+VFELGLWSADIMC QEVD+FQDLE+E+KH G Sbjct: 169 DYLANDHWRSLYFHIPRNMLSWGWRKRKLVFELGLWSADIMCLQEVDKFQDLEEEMKHRG 228 Query: 71 YSGIWKMRTGIPIDGCATFWRA 6 Y GIWKMRTG +DGCA FWR+ Sbjct: 229 YCGIWKMRTGNAVDGCAIFWRS 250 >ref|XP_004498648.1| PREDICTED: LOW QUALITY PROTEIN: carbon catabolite repressor protein 4 homolog 6-like [Cicer arietinum] Length = 840 Score = 142 bits (359), Expect = 4e-32 Identities = 60/83 (72%), Positives = 71/83 (85%) Frame = -3 Query: 251 DYLAVKHRRELYYHIPRHILDWEWRKRKIVFELGLWSADIMCFQEVDRFQDLEDELKHHG 72 DYLA H ++LYYHIP ++LDW+WRKRKI+FELGLWSADIMCFQEVDRFQ+L ++LK G Sbjct: 162 DYLAKDHWKKLYYHIPPYMLDWQWRKRKIIFELGLWSADIMCFQEVDRFQELAEDLKFKG 221 Query: 71 YSGIWKMRTGIPIDGCATFWRAA 3 Y G WKMRTG P+DGCA FWR + Sbjct: 222 YRGTWKMRTGNPVDGCAIFWRTS 244 >gb|EYU21940.1| hypothetical protein MIMGU_mgv1a002905mg [Mimulus guttatus] Length = 627 Score = 142 bits (357), Expect = 6e-32 Identities = 60/83 (72%), Positives = 71/83 (85%) Frame = -3 Query: 251 DYLAVKHRRELYYHIPRHILDWEWRKRKIVFELGLWSADIMCFQEVDRFQDLEDELKHHG 72 +YLA+ H ++LY+HIPR++LDW WRKR I FELGLWSADI+CFQEVDRFQ++E ELK G Sbjct: 42 EYLAIDHFQKLYFHIPRYMLDWNWRKRNICFELGLWSADILCFQEVDRFQEMEAELKPRG 101 Query: 71 YSGIWKMRTGIPIDGCATFWRAA 3 YSGIWKMRTG P DGCA FWR + Sbjct: 102 YSGIWKMRTGDPADGCAIFWRVS 124 >ref|XP_007161236.1| hypothetical protein PHAVU_001G053400g [Phaseolus vulgaris] gi|561034700|gb|ESW33230.1| hypothetical protein PHAVU_001G053400g [Phaseolus vulgaris] Length = 827 Score = 140 bits (354), Expect = 1e-31 Identities = 59/81 (72%), Positives = 69/81 (85%) Frame = -3 Query: 251 DYLAVKHRRELYYHIPRHILDWEWRKRKIVFELGLWSADIMCFQEVDRFQDLEDELKHHG 72 DYLA+ HR +LY+HIP +ILDW+WRKR I+FELGLWSADI+C QEVDRF +L +ELK G Sbjct: 168 DYLALDHRNKLYFHIPSYILDWQWRKRSILFELGLWSADILCLQEVDRFHELAEELKPRG 227 Query: 71 YSGIWKMRTGIPIDGCATFWR 9 Y GIWKMRTG P+DGCA FWR Sbjct: 228 YCGIWKMRTGNPVDGCAIFWR 248 >ref|XP_002871471.1| endonuclease/exonuclease/phosphatase family protein [Arabidopsis lyrata subsp. lyrata] gi|297317308|gb|EFH47730.1| endonuclease/exonuclease/phosphatase family protein [Arabidopsis lyrata subsp. lyrata] Length = 753 Score = 140 bits (353), Expect = 2e-31 Identities = 60/82 (73%), Positives = 69/82 (84%) Frame = -3 Query: 251 DYLAVKHRRELYYHIPRHILDWEWRKRKIVFELGLWSADIMCFQEVDRFQDLEDELKHHG 72 DYLA H R LY+HIPR++L W WRK K+VFELGLWSADIMC QEVD+FQDLE+E+KH G Sbjct: 192 DYLANDHWRSLYFHIPRNMLSWGWRKSKLVFELGLWSADIMCLQEVDKFQDLEEEMKHRG 251 Query: 71 YSGIWKMRTGIPIDGCATFWRA 6 YS IWKMRTG +DGCA FWR+ Sbjct: 252 YSAIWKMRTGNAVDGCAIFWRS 273 >ref|XP_006854929.1| hypothetical protein AMTR_s00052p00118920, partial [Amborella trichopoda] gi|548858654|gb|ERN16396.1| hypothetical protein AMTR_s00052p00118920, partial [Amborella trichopoda] Length = 887 Score = 139 bits (350), Expect = 4e-31 Identities = 59/81 (72%), Positives = 69/81 (85%) Frame = -3 Query: 251 DYLAVKHRRELYYHIPRHILDWEWRKRKIVFELGLWSADIMCFQEVDRFQDLEDELKHHG 72 DYLA HR +LY+HIP HILDWEWRKR+I+ ELGLWS DIMC QEVD+FQDL +EL+ G Sbjct: 108 DYLARDHRHKLYFHIPPHILDWEWRKRRILLELGLWSPDIMCLQEVDKFQDLAEELQLRG 167 Query: 71 YSGIWKMRTGIPIDGCATFWR 9 ++GIWK RTG+PIDGCA FWR Sbjct: 168 FAGIWKERTGLPIDGCAIFWR 188 >ref|XP_003588706.1| Carbon catabolite repressor protein-like protein [Medicago truncatula] gi|355477754|gb|AES58957.1| Carbon catabolite repressor protein-like protein [Medicago truncatula] Length = 848 Score = 139 bits (350), Expect = 4e-31 Identities = 59/83 (71%), Positives = 70/83 (84%) Frame = -3 Query: 251 DYLAVKHRRELYYHIPRHILDWEWRKRKIVFELGLWSADIMCFQEVDRFQDLEDELKHHG 72 DYLA+ H R+LYYHIP ++L+W+WRK KIV ELGLWSADIMC QEVDRF +LE++LK G Sbjct: 177 DYLAMDHWRKLYYHIPSYMLNWQWRKSKIVLELGLWSADIMCLQEVDRFHELEEDLKFKG 236 Query: 71 YSGIWKMRTGIPIDGCATFWRAA 3 Y GIWKMRTG P+DGCA FWR + Sbjct: 237 YRGIWKMRTGNPVDGCAIFWRTS 259 >gb|EXB94139.1| hypothetical protein L484_004664 [Morus notabilis] Length = 760 Score = 139 bits (349), Expect = 5e-31 Identities = 62/85 (72%), Positives = 71/85 (83%), Gaps = 2/85 (2%) Frame = -3 Query: 251 DYLAV--KHRRELYYHIPRHILDWEWRKRKIVFELGLWSADIMCFQEVDRFQDLEDELKH 78 DY+A+ +HR EL+ HIPR ILDW WRK I+FELGLWS DIMCFQEVDRFQDLE+ELK Sbjct: 174 DYVALGYRHRMELFSHIPRRILDWGWRKGNIIFELGLWSTDIMCFQEVDRFQDLEEELKL 233 Query: 77 HGYSGIWKMRTGIPIDGCATFWRAA 3 GY+GIWK RTG P+DGCA FWRA+ Sbjct: 234 RGYNGIWKRRTGKPLDGCAIFWRAS 258 >ref|XP_006399637.1| hypothetical protein EUTSA_v10012752mg [Eutrema salsugineum] gi|557100727|gb|ESQ41090.1| hypothetical protein EUTSA_v10012752mg [Eutrema salsugineum] Length = 764 Score = 139 bits (349), Expect = 5e-31 Identities = 60/82 (73%), Positives = 69/82 (84%) Frame = -3 Query: 251 DYLAVKHRRELYYHIPRHILDWEWRKRKIVFELGLWSADIMCFQEVDRFQDLEDELKHHG 72 DYLA H R LY+HIPR++L W WRK K+VFELGLWSADIMC QEVD+FQDLE+E+K G Sbjct: 208 DYLANDHWRNLYFHIPRNMLSWGWRKNKLVFELGLWSADIMCLQEVDKFQDLEEEMKIRG 267 Query: 71 YSGIWKMRTGIPIDGCATFWRA 6 YSGIWKMRTG +DGCA FWR+ Sbjct: 268 YSGIWKMRTGNAVDGCAIFWRS 289 >ref|XP_004245215.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6-like [Solanum lycopersicum] Length = 873 Score = 139 bits (349), Expect = 5e-31 Identities = 61/83 (73%), Positives = 69/83 (83%) Frame = -3 Query: 251 DYLAVKHRRELYYHIPRHILDWEWRKRKIVFELGLWSADIMCFQEVDRFQDLEDELKHHG 72 DYLA H+R+LY+HIP+HILDWEWRKR I+ ELG WSADI+C QEVDRFQ+LE ELK G Sbjct: 214 DYLANDHQRKLYFHIPQHILDWEWRKRSILSELGWWSADILCLQEVDRFQELEAELKLRG 273 Query: 71 YSGIWKMRTGIPIDGCATFWRAA 3 YSGIWK RTG P DGCA FW A+ Sbjct: 274 YSGIWKRRTGDPADGCAIFWHAS 296