BLASTX nr result
ID: Sinomenium21_contig00036707
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00036707 (621 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007030246.1| Uncharacterized protein TCM_026051 [Theobrom... 50 3e-06 >ref|XP_007030246.1| Uncharacterized protein TCM_026051 [Theobroma cacao] gi|508718851|gb|EOY10748.1| Uncharacterized protein TCM_026051 [Theobroma cacao] Length = 278 Score = 50.4 bits (119), Expect(2) = 3e-06 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 1/56 (1%) Frame = +3 Query: 423 QEGASLPIISLQPVVXXXXXXXXXXXXXXTRSLINIIYRVEFGSK-NEDNGSDKIE 587 QE ASLPIISLQPVV T++++NIIYR EF S+ +ED+G D++E Sbjct: 222 QERASLPIISLQPVVAGAARKTSRAVGQATKTIMNIIYRGEFSSEHDEDSGIDQVE 277 Score = 26.9 bits (58), Expect(2) = 3e-06 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 Query: 293 SQTIQAAETGI*QIGTLA*Q 352 +Q +QAAE GI QIG+LA Q Sbjct: 196 AQAVQAAEAGIRQIGSLAHQ 215