BLASTX nr result
ID: Sinomenium21_contig00036676
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00036676 (719 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002992245.1| ubiquitin-conjugating enzyme 35, E2 [Selagin... 58 4e-06 >ref|XP_002992245.1| ubiquitin-conjugating enzyme 35, E2 [Selaginella moellendorffii] gi|300140012|gb|EFJ06742.1| ubiquitin-conjugating enzyme 35, E2 [Selaginella moellendorffii] Length = 175 Score = 57.8 bits (138), Expect = 4e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +3 Query: 597 INSL*CVAIFLVCDIIGGVFKLELFLPEEYPMAAPKVRFLT 719 I+ L C + L+C GG F+LELFLPEEYPMAAPKVRFLT Sbjct: 57 ISFLLCSSSELLCFFSGGAFRLELFLPEEYPMAAPKVRFLT 97