BLASTX nr result
ID: Sinomenium21_contig00036569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00036569 (377 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG50886.1|AC025294_24 hypothetical protein [Arabidopsis thal... 58 2e-06 >gb|AAG50886.1|AC025294_24 hypothetical protein [Arabidopsis thaliana] Length = 629 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/89 (34%), Positives = 50/89 (56%), Gaps = 1/89 (1%) Frame = +1 Query: 100 RNLSSVSGEKICKPKEQGSLGSRRVKKMNLSEIPRLIWWLALFKKFM*TQ*IRVKYPMDK 279 R + VS + ICKPK++G LG R + + N+ + +LIW + + + ++ + Sbjct: 260 RRKAKVSWDDICKPKQEGGLGLRSLTEANVVSVLKLIWRVTSNDDSLWVKWSKMNLLKQE 319 Query: 280 SLSSFPVNKN-ASWVFKKMLKYREKVEPF 363 S S N + SW++KKMLKYRE +PF Sbjct: 320 SFWSLTPNSSLGSWMWKKMLKYRETAKPF 348