BLASTX nr result
ID: Sinomenium21_contig00036410
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00036410 (401 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006840453.1| hypothetical protein AMTR_s00045p00173390 [A... 69 9e-10 >ref|XP_006840453.1| hypothetical protein AMTR_s00045p00173390 [Amborella trichopoda] gi|548842171|gb|ERN02128.1| hypothetical protein AMTR_s00045p00173390 [Amborella trichopoda] Length = 990 Score = 68.6 bits (166), Expect = 9e-10 Identities = 37/79 (46%), Positives = 52/79 (65%) Frame = -2 Query: 238 MLKALSASCSYGRFRRPSAKFPSSSLFNGGENKSPVVRFFDSLRLSNAINPAFCNRVFFC 59 MLK LSASC +GR + S++ P S +GGE +SP++R S++ + +P + RVFFC Sbjct: 1 MLKVLSASCLHGRLQCVSSRLPIHSS-HGGEGRSPLLRLLRSMKSPISGSPYYRRRVFFC 59 Query: 58 SESGDGSGSNPVVEAEAES 2 SESG GS VEA+AE+ Sbjct: 60 SESGGNDGSCETVEAKAEN 78