BLASTX nr result
ID: Sinomenium21_contig00036304
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00036304 (277 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524580.1| conserved hypothetical protein [Ricinus comm... 62 1e-07 gb|EXB40466.1| hypothetical protein L484_013769 [Morus notabilis] 60 2e-07 ref|XP_006469372.1| PREDICTED: uncharacterized protein At4g08330... 58 2e-06 ref|XP_006583257.1| PREDICTED: uncharacterized protein At4g08330... 57 2e-06 ref|XP_002320553.2| hypothetical protein POPTR_0014s17240g [Popu... 57 3e-06 >ref|XP_002524580.1| conserved hypothetical protein [Ricinus communis] gi|223536133|gb|EEF37788.1| conserved hypothetical protein [Ricinus communis] Length = 122 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 185 MSQADVSYSCGSCGYPLNLISSNRIASSIDS 277 MSQADVSYSCGSCGYPLNL SSNRI SSIDS Sbjct: 1 MSQADVSYSCGSCGYPLNLSSSNRITSSIDS 31 >gb|EXB40466.1| hypothetical protein L484_013769 [Morus notabilis] Length = 493 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +2 Query: 185 MSQADVSYSCGSCGYPLNLISSNRIASSIDS 277 MSQADVSYSCGSCGYPLNL SSNRI S IDS Sbjct: 1 MSQADVSYSCGSCGYPLNLTSSNRITSGIDS 31 >ref|XP_006469372.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like [Citrus sinensis] Length = 125 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = +2 Query: 185 MSQADVSYSCGSCGYPLNLISSNRIASSIDS 277 MSQADVSYSCGSCGYPLNL SSNRI S I S Sbjct: 1 MSQADVSYSCGSCGYPLNLTSSNRITSGIGS 31 >ref|XP_006583257.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like [Glycine max] Length = 122 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 185 MSQADVSYSCGSCGYPLNLISSNRIASSIDS 277 MSQAD+SYSCGSCGYPLNL SSNRI S+I S Sbjct: 1 MSQADISYSCGSCGYPLNLTSSNRITSNIAS 31 >ref|XP_002320553.2| hypothetical protein POPTR_0014s17240g [Populus trichocarpa] gi|550324393|gb|EEE98868.2| hypothetical protein POPTR_0014s17240g [Populus trichocarpa] Length = 295 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 185 MSQADVSYSCGSCGYPLNLISSNRIASSIDS 277 MSQ+D+SYSCGSCGYPLNL SSNRI S+I S Sbjct: 1 MSQSDISYSCGSCGYPLNLTSSNRITSNIGS 31