BLASTX nr result
ID: Sinomenium21_contig00036046
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00036046 (276 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007134424.1| hypothetical protein PHAVU_010G046400g [Phas... 44 1e-07 ref|XP_006386045.1| tRNA synthetase class II family protein [Pop... 42 1e-07 >ref|XP_007134424.1| hypothetical protein PHAVU_010G046400g [Phaseolus vulgaris] gi|561007469|gb|ESW06418.1| hypothetical protein PHAVU_010G046400g [Phaseolus vulgaris] Length = 583 Score = 43.9 bits (102), Expect(2) = 1e-07 Identities = 24/51 (47%), Positives = 28/51 (54%) Frame = -2 Query: 275 KVYEIGRIFRNEGISILHSLEFTSTETVQVLKRIGAKGIFLLEGTMSCLFA 123 KVYEIGRIFRNEGIS H+ EFT+ E + + F E C A Sbjct: 305 KVYEIGRIFRNEGISTRHNPEFTTIEMYEAYSDYQSMMSFAEEIVTRCALA 355 Score = 37.7 bits (86), Expect(2) = 1e-07 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 54 QGSNICLEQPWRRETMHN 1 QG ICLE+PWRR+TMHN Sbjct: 365 QGVEICLEKPWRRDTMHN 382 >ref|XP_006386045.1| tRNA synthetase class II family protein [Populus trichocarpa] gi|550343668|gb|ERP63842.1| tRNA synthetase class II family protein [Populus trichocarpa] Length = 591 Score = 42.4 bits (98), Expect(2) = 1e-07 Identities = 23/51 (45%), Positives = 28/51 (54%) Frame = -2 Query: 275 KVYEIGRIFRNEGISILHSLEFTSTETVQVLKRIGAKGIFLLEGTMSCLFA 123 KVYEIGRIFRNEG+S H+ EFT+ E + + I E C A Sbjct: 311 KVYEIGRIFRNEGLSPRHNPEFTTIEMYEAYSDYQSMMIMAEEIVTRCALA 361 Score = 38.9 bits (89), Expect(2) = 1e-07 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 54 QGSNICLEQPWRRETMHN 1 QG ICLE+PWRRETMHN Sbjct: 371 QGVEICLERPWRRETMHN 388