BLASTX nr result
ID: Sinomenium21_contig00035872
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00035872 (272 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006466258.1| PREDICTED: peroxidase 17-like [Citrus sinensis] 57 3e-06 >ref|XP_006466258.1| PREDICTED: peroxidase 17-like [Citrus sinensis] Length = 326 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +3 Query: 141 MSLYLLCFFFLQIATATASSDPLRPGFYAETCPNAESIVGDVI 269 MS ++L FF L I ATA DPLRPG+Y+ETCP AESIVGDVI Sbjct: 1 MSFWIL-FFLLLITMATA--DPLRPGYYSETCPEAESIVGDVI 40