BLASTX nr result
ID: Sinomenium21_contig00035747
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00035747 (363 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69473.1| hypothetical protein VITISV_014374 [Vitis vinifera] 56 6e-06 >emb|CAN69473.1| hypothetical protein VITISV_014374 [Vitis vinifera] Length = 265 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/47 (55%), Positives = 36/47 (76%) Frame = -1 Query: 294 MSKGDDYRFLPLRDAIICLDQKVNLLGVVVTEFGLPRKSKGTGNLFH 154 M DDYRF+ + DA+ L+QKVN++GVVV E G+P++SKGTG + H Sbjct: 1 MGGEDDYRFMAIEDAMASLNQKVNIIGVVV-EMGMPKRSKGTGYIRH 46