BLASTX nr result
ID: Sinomenium21_contig00035707
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00035707 (284 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285409.1| PREDICTED: uncharacterized protein LOC100262... 59 7e-07 >ref|XP_002285409.1| PREDICTED: uncharacterized protein LOC100262987 [Vitis vinifera] gi|297738997|emb|CBI28242.3| unnamed protein product [Vitis vinifera] Length = 281 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = -2 Query: 283 QNIKHIAKRSKLIGDVAEKIVEDWNAQKKAFLEQTRSSQRPSDEGNQ 143 QNIKHI++ KLIGDV K E+WNAQK+ F ++T +QRP++E Q Sbjct: 215 QNIKHISEDKKLIGDVVNKTAENWNAQKEVFYQKTGLNQRPAEEHRQ 261