BLASTX nr result
ID: Sinomenium21_contig00035400
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00035400 (464 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC11329.1| hypothetical protein L484_006894 [Morus notabilis] 75 7e-12 gb|EXB28409.1| hypothetical protein L484_002217 [Morus notabilis] 75 9e-12 >gb|EXC11329.1| hypothetical protein L484_006894 [Morus notabilis] Length = 433 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/66 (51%), Positives = 50/66 (75%) Frame = +3 Query: 3 IFEVIINHAEATATYGILPFPSLMYEVLMSEKNIKVETEVLENTRKPIKISHKLLQGRHV 182 IFE I++H E T++ LPFPSL+Y +LMS++NI+ +VLE KPI+IS KL + +H+ Sbjct: 307 IFEEIVSHTEVTSSKPALPFPSLVYGILMSQQNIRTHEDVLEPPTKPIRISQKLRECKHM 366 Query: 183 HDIQGE 200 +D+QGE Sbjct: 367 NDVQGE 372 >gb|EXB28409.1| hypothetical protein L484_002217 [Morus notabilis] Length = 374 Score = 75.1 bits (183), Expect = 9e-12 Identities = 33/66 (50%), Positives = 49/66 (74%) Frame = +3 Query: 3 IFEVIINHAEATATYGILPFPSLMYEVLMSEKNIKVETEVLENTRKPIKISHKLLQGRHV 182 IFE I++HAE T++ +PFPSL+Y +LM NIK +VLE +P+++S KL +G+HV Sbjct: 220 IFEEIVSHAEVTSSKPAIPFPSLVYGILMPHHNIKTYEDVLEPPTEPLRVSQKLREGKHV 279 Query: 183 HDIQGE 200 +D+QGE Sbjct: 280 NDVQGE 285