BLASTX nr result
ID: Sinomenium21_contig00035307
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00035307 (467 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS49379.1| Retrovirus-related Pol polyprotein LINE-1 [Tritic... 45 8e-07 >gb|EMS49379.1| Retrovirus-related Pol polyprotein LINE-1 [Triticum urartu] Length = 882 Score = 44.7 bits (104), Expect(2) = 8e-07 Identities = 25/73 (34%), Positives = 38/73 (52%) Frame = +3 Query: 6 KLDIWREPLEPIEFKINRTKTEYTKYNFSESRL*KYRWRIVKIFFP*KETVKIEGQEILR 185 KL++WR+ LE F+++RTKTEY FS +R +E V ++GQ + R Sbjct: 278 KLELWRQTLESKGFRLSRTKTEYMMCGFSTTRC-------------EEEEVSLDGQVVPR 324 Query: 186 CKIFWCLARLFKK 224 FW L L ++ Sbjct: 325 KDTFWYLGSLLQE 337 Score = 33.9 bits (76), Expect(2) = 8e-07 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = +1 Query: 253 IKACWVKWWSIFGVLYDRRIPFQLKPK 333 IKA W+KW G+L D+R+P +LK K Sbjct: 349 IKAGWMKWRQASGILCDKRVPQKLKGK 375