BLASTX nr result
ID: Sinomenium21_contig00035089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00035089 (338 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514949.1| OTU domain-containing protein 6B, putative [... 70 2e-10 gb|EYU42104.1| hypothetical protein MIMGU_mgv1a025113mg, partial... 69 7e-10 ref|XP_006379933.1| hypothetical protein POPTR_0008s17740g [Popu... 68 1e-09 ref|XP_002311721.2| hypothetical protein POPTR_0008s17740g [Popu... 68 1e-09 ref|XP_006379934.1| hypothetical protein POPTR_0008s17740g [Popu... 67 3e-09 gb|EXC30911.1| OTU domain-containing protein [Morus notabilis] 66 6e-09 ref|XP_004136582.1| PREDICTED: OTU domain-containing protein At3... 65 7e-09 ref|XP_007145652.1| hypothetical protein PHAVU_007G257000g [Phas... 65 1e-08 ref|XP_002534273.1| cysteine-type peptidase, putative [Ricinus c... 65 1e-08 ref|XP_006591461.1| PREDICTED: OTU domain-containing protein At3... 65 1e-08 ref|XP_007163740.1| hypothetical protein PHAVU_001G260200g [Phas... 65 1e-08 ref|XP_002323302.2| OTU-like cysteine protease family protein [P... 65 1e-08 ref|XP_004310203.1| PREDICTED: OTU domain-containing protein At3... 64 2e-08 ref|XP_007202322.1| hypothetical protein PRUPE_ppa008123mg [Prun... 64 2e-08 ref|XP_004291162.1| PREDICTED: OTU domain-containing protein At3... 64 3e-08 ref|XP_006490038.1| PREDICTED: OTU domain-containing protein At3... 63 4e-08 ref|XP_006421489.1| hypothetical protein CICLE_v10005351mg [Citr... 63 4e-08 ref|XP_006421488.1| hypothetical protein CICLE_v10005351mg [Citr... 63 4e-08 ref|XP_007045037.1| Cysteine proteinases superfamily protein iso... 63 4e-08 ref|XP_007045036.1| Cysteine proteinases superfamily protein iso... 63 4e-08 >ref|XP_002514949.1| OTU domain-containing protein 6B, putative [Ricinus communis] gi|223546000|gb|EEF47503.1| OTU domain-containing protein 6B, putative [Ricinus communis] Length = 167 Score = 70.5 bits (171), Expect = 2e-10 Identities = 36/52 (69%), Positives = 40/52 (76%) Frame = +1 Query: 181 LISHWNLLIICMDFGLGIPGDGRCLFRSVTYGALLRAGKPSPTESLQKELAD 336 +IS L+I G GIPGDGRCLFRSV +GA LR GKPSPTESL+KELAD Sbjct: 9 IISSVLRLLIGFWAGTGIPGDGRCLFRSVVHGACLREGKPSPTESLEKELAD 60 >gb|EYU42104.1| hypothetical protein MIMGU_mgv1a025113mg, partial [Mimulus guttatus] Length = 147 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +1 Query: 214 MDFGLGIPGDGRCLFRSVTYGALLRAGKPSPTESLQKELAD 336 MD G GIPGDGRCLFRSV +GA LRAGKPSP+E +KELAD Sbjct: 1 MDLGSGIPGDGRCLFRSVVHGACLRAGKPSPSEIHEKELAD 41 >ref|XP_006379933.1| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] gi|550333320|gb|ERP57730.1| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] Length = 163 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 226 LGIPGDGRCLFRSVTYGALLRAGKPSPTESLQKELAD 336 LGIPGDGRCLFRSV +GA LR GKPSP+ESL+KELAD Sbjct: 16 LGIPGDGRCLFRSVVHGACLRTGKPSPSESLEKELAD 52 >ref|XP_002311721.2| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] gi|550333319|gb|EEE89088.2| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] Length = 163 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 226 LGIPGDGRCLFRSVTYGALLRAGKPSPTESLQKELAD 336 LGIPGDGRCLFRSV +GA LR GKPSP+ESL+KELAD Sbjct: 16 LGIPGDGRCLFRSVVHGACLRTGKPSPSESLEKELAD 52 >ref|XP_006379934.1| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] gi|550333321|gb|ERP57731.1| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] Length = 155 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 229 GIPGDGRCLFRSVTYGALLRAGKPSPTESLQKELAD 336 GIPGDGRCLFRSV +GA LR GKPSP+ESL+KELAD Sbjct: 9 GIPGDGRCLFRSVVHGACLRTGKPSPSESLEKELAD 44 >gb|EXC30911.1| OTU domain-containing protein [Morus notabilis] Length = 893 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +1 Query: 229 GIPGDGRCLFRSVTYGALLRAGKPSPTESLQKELAD 336 GIPGDGRCLFRSV +GA LR+GKP+P+ESLQ+ELAD Sbjct: 750 GIPGDGRCLFRSVAHGACLRSGKPAPSESLQRELAD 785 >ref|XP_004136582.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis sativus] gi|449522883|ref|XP_004168455.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis sativus] Length = 286 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = +1 Query: 226 LGIPGDGRCLFRSVTYGALLRAGKPSPTESLQKELAD 336 +GIPGDGRCLFRSV +GA LR+GKP+P+ESLQ++LAD Sbjct: 141 IGIPGDGRCLFRSVAHGACLRSGKPAPSESLQRDLAD 177 >ref|XP_007145652.1| hypothetical protein PHAVU_007G257000g [Phaseolus vulgaris] gi|561018842|gb|ESW17646.1| hypothetical protein PHAVU_007G257000g [Phaseolus vulgaris] Length = 339 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +1 Query: 226 LGIPGDGRCLFRSVTYGALLRAGKPSPTESLQKELAD 336 +GIPGDGRCLFRSV+ GA LR+GKP PTES+Q+ELAD Sbjct: 195 IGIPGDGRCLFRSVSRGACLRSGKPPPTESVQRELAD 231 >ref|XP_002534273.1| cysteine-type peptidase, putative [Ricinus communis] gi|223525596|gb|EEF28110.1| cysteine-type peptidase, putative [Ricinus communis] Length = 343 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +1 Query: 229 GIPGDGRCLFRSVTYGALLRAGKPSPTESLQKELAD 336 GIPGDGRCLFRSV +GA LR GKP+P+ESLQ+ELAD Sbjct: 200 GIPGDGRCLFRSVAHGASLRTGKPAPSESLQRELAD 235 >ref|XP_006591461.1| PREDICTED: OTU domain-containing protein At3g57810-like isoform X2 [Glycine max] Length = 146 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 226 LGIPGDGRCLFRSVTYGALLRAGKPSPTESLQKELAD 336 LGIPGDGRCLFRSV YGA LR+G+PSP+ S QKELAD Sbjct: 8 LGIPGDGRCLFRSVVYGACLRSGEPSPSLSRQKELAD 44 >ref|XP_007163740.1| hypothetical protein PHAVU_001G260200g [Phaseolus vulgaris] gi|561037204|gb|ESW35734.1| hypothetical protein PHAVU_001G260200g [Phaseolus vulgaris] Length = 150 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 226 LGIPGDGRCLFRSVTYGALLRAGKPSPTESLQKELAD 336 LGIPGDGRCLFRSV YGA LR+G+PSP+ S QKELAD Sbjct: 8 LGIPGDGRCLFRSVVYGACLRSGEPSPSLSRQKELAD 44 >ref|XP_002323302.2| OTU-like cysteine protease family protein [Populus trichocarpa] gi|550320875|gb|EEF05063.2| OTU-like cysteine protease family protein [Populus trichocarpa] Length = 342 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/37 (72%), Positives = 35/37 (94%) Frame = +1 Query: 226 LGIPGDGRCLFRSVTYGALLRAGKPSPTESLQKELAD 336 +GIPGDGRCLFRSV +GA +R+GKP+P+E+LQ+ELAD Sbjct: 198 IGIPGDGRCLFRSVAHGACIRSGKPAPSENLQRELAD 234 >ref|XP_004310203.1| PREDICTED: OTU domain-containing protein At3g57810-like [Fragaria vesca subsp. vesca] Length = 164 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 226 LGIPGDGRCLFRSVTYGALLRAGKPSPTESLQKELAD 336 LGI GDGRCLFRSV +GA LRAGKPSP++S QKELAD Sbjct: 8 LGIRGDGRCLFRSVVHGACLRAGKPSPSDSYQKELAD 44 >ref|XP_007202322.1| hypothetical protein PRUPE_ppa008123mg [Prunus persica] gi|462397853|gb|EMJ03521.1| hypothetical protein PRUPE_ppa008123mg [Prunus persica] Length = 344 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 226 LGIPGDGRCLFRSVTYGALLRAGKPSPTESLQKELAD 336 +GIPGDGRCLFRSV +GA LRAGK +P ESLQ+ELAD Sbjct: 200 IGIPGDGRCLFRSVAHGAYLRAGKAAPAESLQRELAD 236 >ref|XP_004291162.1| PREDICTED: OTU domain-containing protein At3g57810-like [Fragaria vesca subsp. vesca] Length = 343 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +1 Query: 226 LGIPGDGRCLFRSVTYGALLRAGKPSPTESLQKELAD 336 +GIPGDGRCLFRSV +GA LRAGK +P++SLQ+ELAD Sbjct: 199 IGIPGDGRCLFRSVAHGACLRAGKSAPSQSLQRELAD 235 >ref|XP_006490038.1| PREDICTED: OTU domain-containing protein At3g57810-like [Citrus sinensis] Length = 341 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = +1 Query: 226 LGIPGDGRCLFRSVTYGALLRAGKPSPTESLQKELAD 336 +GIPGDGRCLFR+V +GA LRAGKP+P+ S+Q+ELAD Sbjct: 197 IGIPGDGRCLFRAVAHGACLRAGKPAPSVSIQRELAD 233 >ref|XP_006421489.1| hypothetical protein CICLE_v10005351mg [Citrus clementina] gi|557523362|gb|ESR34729.1| hypothetical protein CICLE_v10005351mg [Citrus clementina] Length = 341 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = +1 Query: 226 LGIPGDGRCLFRSVTYGALLRAGKPSPTESLQKELAD 336 +GIPGDGRCLFR+V +GA LRAGKP+P+ S+Q+ELAD Sbjct: 197 IGIPGDGRCLFRAVAHGACLRAGKPAPSVSIQRELAD 233 >ref|XP_006421488.1| hypothetical protein CICLE_v10005351mg [Citrus clementina] gi|557523361|gb|ESR34728.1| hypothetical protein CICLE_v10005351mg [Citrus clementina] Length = 311 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = +1 Query: 226 LGIPGDGRCLFRSVTYGALLRAGKPSPTESLQKELAD 336 +GIPGDGRCLFR+V +GA LRAGKP+P+ S+Q+ELAD Sbjct: 167 IGIPGDGRCLFRAVAHGACLRAGKPAPSVSIQRELAD 203 >ref|XP_007045037.1| Cysteine proteinases superfamily protein isoform 2, partial [Theobroma cacao] gi|508708972|gb|EOY00869.1| Cysteine proteinases superfamily protein isoform 2, partial [Theobroma cacao] Length = 165 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 229 GIPGDGRCLFRSVTYGALLRAGKPSPTESLQKELAD 336 GIPGDGRCLFRSV +GA LRAGK SP+ES QKELAD Sbjct: 19 GIPGDGRCLFRSVVHGAWLRAGKQSPSESHQKELAD 54 >ref|XP_007045036.1| Cysteine proteinases superfamily protein isoform 1 [Theobroma cacao] gi|508708971|gb|EOY00868.1| Cysteine proteinases superfamily protein isoform 1 [Theobroma cacao] Length = 175 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 229 GIPGDGRCLFRSVTYGALLRAGKPSPTESLQKELAD 336 GIPGDGRCLFRSV +GA LRAGK SP+ES QKELAD Sbjct: 29 GIPGDGRCLFRSVVHGAWLRAGKQSPSESHQKELAD 64