BLASTX nr result
ID: Sinomenium21_contig00035088
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00035088 (298 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514949.1| OTU domain-containing protein 6B, putative [... 65 1e-08 gb|EXC30911.1| OTU domain-containing protein [Morus notabilis] 62 1e-07 ref|XP_004310203.1| PREDICTED: OTU domain-containing protein At3... 62 1e-07 ref|XP_002534273.1| cysteine-type peptidase, putative [Ricinus c... 61 1e-07 ref|XP_006379933.1| hypothetical protein POPTR_0008s17740g [Popu... 61 2e-07 ref|XP_002311721.2| hypothetical protein POPTR_0008s17740g [Popu... 61 2e-07 ref|XP_006379934.1| hypothetical protein POPTR_0008s17740g [Popu... 60 2e-07 ref|XP_007045037.1| Cysteine proteinases superfamily protein iso... 60 2e-07 ref|XP_006850126.1| hypothetical protein AMTR_s00022p00229870 [A... 60 3e-07 ref|XP_007202322.1| hypothetical protein PRUPE_ppa008123mg [Prun... 60 3e-07 gb|EYU42104.1| hypothetical protein MIMGU_mgv1a025113mg, partial... 59 5e-07 ref|XP_007045036.1| Cysteine proteinases superfamily protein iso... 59 9e-07 ref|XP_004136582.1| PREDICTED: OTU domain-containing protein At3... 59 9e-07 ref|XP_003632695.1| PREDICTED: OTU domain-containing protein At3... 59 9e-07 emb|CBI29898.3| unnamed protein product [Vitis vinifera] 59 9e-07 emb|CAN60311.1| hypothetical protein VITISV_002512 [Vitis vinifera] 59 9e-07 ref|XP_002323302.2| OTU-like cysteine protease family protein [P... 58 1e-06 ref|XP_007145652.1| hypothetical protein PHAVU_007G257000g [Phas... 58 2e-06 gb|ABR16871.1| unknown [Picea sitchensis] 58 2e-06 ref|XP_006660765.1| PREDICTED: OTU domain-containing protein At3... 57 2e-06 >ref|XP_002514949.1| OTU domain-containing protein 6B, putative [Ricinus communis] gi|223546000|gb|EEF47503.1| OTU domain-containing protein 6B, putative [Ricinus communis] Length = 167 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -3 Query: 113 TGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELAD 3 TGI GDGRCLFRSV HGA LREGKPSP E ++KELAD Sbjct: 24 TGIPGDGRCLFRSVVHGACLREGKPSPTESLEKELAD 60 >gb|EXC30911.1| OTU domain-containing protein [Morus notabilis] Length = 893 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 113 TGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELAD 3 TGI GDGRCLFRSV HGA LR GKP+P E +Q+ELAD Sbjct: 749 TGIPGDGRCLFRSVAHGACLRSGKPAPSESLQRELAD 785 >ref|XP_004310203.1| PREDICTED: OTU domain-containing protein At3g57810-like [Fragaria vesca subsp. vesca] Length = 164 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = -3 Query: 119 TWTGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELAD 3 T GI GDGRCLFRSV HGA LR GKPSP + QKELAD Sbjct: 6 TMLGIRGDGRCLFRSVVHGACLRAGKPSPSDSYQKELAD 44 >ref|XP_002534273.1| cysteine-type peptidase, putative [Ricinus communis] gi|223525596|gb|EEF28110.1| cysteine-type peptidase, putative [Ricinus communis] Length = 343 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 113 TGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELAD 3 TGI GDGRCLFRSV HGA LR GKP+P E +Q+ELAD Sbjct: 199 TGIPGDGRCLFRSVAHGASLRTGKPAPSESLQRELAD 235 >ref|XP_006379933.1| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] gi|550333320|gb|ERP57730.1| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] Length = 163 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -3 Query: 119 TWTGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELAD 3 T GI GDGRCLFRSV HGA LR GKPSP E ++KELAD Sbjct: 14 TALGIPGDGRCLFRSVVHGACLRTGKPSPSESLEKELAD 52 >ref|XP_002311721.2| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] gi|550333319|gb|EEE89088.2| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] Length = 163 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -3 Query: 119 TWTGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELAD 3 T GI GDGRCLFRSV HGA LR GKPSP E ++KELAD Sbjct: 14 TALGIPGDGRCLFRSVVHGACLRTGKPSPSESLEKELAD 52 >ref|XP_006379934.1| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] gi|550333321|gb|ERP57731.1| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] Length = 155 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 110 GIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELAD 3 GI GDGRCLFRSV HGA LR GKPSP E ++KELAD Sbjct: 9 GIPGDGRCLFRSVVHGACLRTGKPSPSESLEKELAD 44 >ref|XP_007045037.1| Cysteine proteinases superfamily protein isoform 2, partial [Theobroma cacao] gi|508708972|gb|EOY00869.1| Cysteine proteinases superfamily protein isoform 2, partial [Theobroma cacao] Length = 165 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -3 Query: 113 TGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELAD 3 TGI GDGRCLFRSV HGA+LR GK SP E QKELAD Sbjct: 18 TGIPGDGRCLFRSVVHGAWLRAGKQSPSESHQKELAD 54 >ref|XP_006850126.1| hypothetical protein AMTR_s00022p00229870 [Amborella trichopoda] gi|548853724|gb|ERN11707.1| hypothetical protein AMTR_s00022p00229870 [Amborella trichopoda] Length = 244 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -3 Query: 113 TGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELAD 3 TGI GDGRC+FRSV HGA LR GKP P E VQ+E+AD Sbjct: 107 TGIPGDGRCMFRSVAHGACLRSGKPPPNESVQREMAD 143 >ref|XP_007202322.1| hypothetical protein PRUPE_ppa008123mg [Prunus persica] gi|462397853|gb|EMJ03521.1| hypothetical protein PRUPE_ppa008123mg [Prunus persica] Length = 344 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 110 GIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELAD 3 GI GDGRCLFRSV HGAYLR GK +P E +Q+ELAD Sbjct: 201 GIPGDGRCLFRSVAHGAYLRAGKAAPAESLQRELAD 236 >gb|EYU42104.1| hypothetical protein MIMGU_mgv1a025113mg, partial [Mimulus guttatus] Length = 147 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 113 TGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELAD 3 +GI GDGRCLFRSV HGA LR GKPSP E +KELAD Sbjct: 5 SGIPGDGRCLFRSVVHGACLRAGKPSPSEIHEKELAD 41 >ref|XP_007045036.1| Cysteine proteinases superfamily protein isoform 1 [Theobroma cacao] gi|508708971|gb|EOY00868.1| Cysteine proteinases superfamily protein isoform 1 [Theobroma cacao] Length = 175 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -3 Query: 110 GIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELAD 3 GI GDGRCLFRSV HGA+LR GK SP E QKELAD Sbjct: 29 GIPGDGRCLFRSVVHGAWLRAGKQSPSESHQKELAD 64 >ref|XP_004136582.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis sativus] gi|449522883|ref|XP_004168455.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis sativus] Length = 286 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -3 Query: 110 GIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELAD 3 GI GDGRCLFRSV HGA LR GKP+P E +Q++LAD Sbjct: 142 GIPGDGRCLFRSVAHGACLRSGKPAPSESLQRDLAD 177 >ref|XP_003632695.1| PREDICTED: OTU domain-containing protein At3g57810-like [Vitis vinifera] Length = 340 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = -3 Query: 113 TGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELAD 3 TGI GDGRCLFRSV HGA LR GKP+P Q+ELAD Sbjct: 196 TGIPGDGRCLFRSVVHGACLRSGKPAPSASCQRELAD 232 >emb|CBI29898.3| unnamed protein product [Vitis vinifera] Length = 189 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = -3 Query: 113 TGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELAD 3 TGI GDGRCLFRSV HGA LR GKP+P Q+ELAD Sbjct: 45 TGIPGDGRCLFRSVVHGACLRSGKPAPSASCQRELAD 81 >emb|CAN60311.1| hypothetical protein VITISV_002512 [Vitis vinifera] Length = 806 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = -3 Query: 113 TGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELAD 3 TGI GDGRCLFRSV HGA LR GKP+P Q+ELAD Sbjct: 662 TGIPGDGRCLFRSVVHGACLRSGKPAPSASCQRELAD 698 >ref|XP_002323302.2| OTU-like cysteine protease family protein [Populus trichocarpa] gi|550320875|gb|EEF05063.2| OTU-like cysteine protease family protein [Populus trichocarpa] Length = 342 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -3 Query: 110 GIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELAD 3 GI GDGRCLFRSV HGA +R GKP+P E +Q+ELAD Sbjct: 199 GIPGDGRCLFRSVAHGACIRSGKPAPSENLQRELAD 234 >ref|XP_007145652.1| hypothetical protein PHAVU_007G257000g [Phaseolus vulgaris] gi|561018842|gb|ESW17646.1| hypothetical protein PHAVU_007G257000g [Phaseolus vulgaris] Length = 339 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -3 Query: 110 GIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELAD 3 GI GDGRCLFRSV+ GA LR GKP P E VQ+ELAD Sbjct: 196 GIPGDGRCLFRSVSRGACLRSGKPPPTESVQRELAD 231 >gb|ABR16871.1| unknown [Picea sitchensis] Length = 411 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -3 Query: 113 TGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELAD 3 T I GDGRCLFR+V HGA LR GKP+P E +Q+ELAD Sbjct: 274 TAIPGDGRCLFRAVAHGASLRSGKPAPNESLQRELAD 310 >ref|XP_006660765.1| PREDICTED: OTU domain-containing protein At3g57810-like isoform X1 [Oryza brachyantha] gi|573957093|ref|XP_006660766.1| PREDICTED: OTU domain-containing protein At3g57810-like isoform X2 [Oryza brachyantha] Length = 308 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -3 Query: 113 TGIHGDGRCLFRSVTHGAYLREGKPSPIECVQKELAD 3 TGI GDGRCLFRSV HGA +R GKP+P E +Q+++AD Sbjct: 164 TGIPGDGRCLFRSVAHGACIRSGKPTPDENLQRKMAD 200