BLASTX nr result
ID: Sinomenium21_contig00035071
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00035071 (218 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006853366.1| hypothetical protein AMTR_s00032p00116380 [A... 59 5e-07 ref|XP_002268694.1| PREDICTED: presqualene diphosphate phosphata... 55 8e-06 >ref|XP_006853366.1| hypothetical protein AMTR_s00032p00116380 [Amborella trichopoda] gi|548857019|gb|ERN14833.1| hypothetical protein AMTR_s00032p00116380 [Amborella trichopoda] Length = 224 Score = 59.3 bits (142), Expect = 5e-07 Identities = 33/71 (46%), Positives = 39/71 (54%) Frame = -3 Query: 213 FSRSVLKALEISGDGRFWFPIPVAFFLSPLSARSDHLRRIXXXXXXXXXXXXXXXXLIKY 34 F RS+LK LEISGDGRFWFPIP++ F L+ L+K+ Sbjct: 41 FPRSLLKLLEISGDGRFWFPIPISLFW----FADPKLKIFSLFLLVGSLLDLALVGLLKF 96 Query: 33 LIRRPRPVYNK 1 IRRPRPVYNK Sbjct: 97 TIRRPRPVYNK 107 >ref|XP_002268694.1| PREDICTED: presqualene diphosphate phosphatase [Vitis vinifera] Length = 214 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/69 (43%), Positives = 39/69 (56%) Frame = -3 Query: 207 RSVLKALEISGDGRFWFPIPVAFFLSPLSARSDHLRRIXXXXXXXXXXXXXXXXLIKYLI 28 RS+LK LE++GDGRF+FP+ V+ S LR I +IKY++ Sbjct: 45 RSLLKTLELAGDGRFFFPVAVSLL------SSSSLRPILIPLLIGLLLDLLLVGVIKYIV 98 Query: 27 RRPRPVYNK 1 RRPRPVYNK Sbjct: 99 RRPRPVYNK 107