BLASTX nr result
ID: Sinomenium21_contig00035049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00035049 (260 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007225607.1| hypothetical protein PRUPE_ppb013332mg [Prun... 65 8e-09 >ref|XP_007225607.1| hypothetical protein PRUPE_ppb013332mg [Prunus persica] gi|462422543|gb|EMJ26806.1| hypothetical protein PRUPE_ppb013332mg [Prunus persica] Length = 198 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/53 (56%), Positives = 40/53 (75%) Frame = +1 Query: 1 MASSLNINALNYTKILISIFDVESYGSWSLQMRTLFISQDFWELVEEGYDEPE 159 MASS N + + + L+ I D ++Y WSLQM+TLFISQD W+LVE+GY+EPE Sbjct: 1 MASSSNSSTIENIQNLMPILDGKNYEYWSLQMKTLFISQDLWDLVEDGYEEPE 53