BLASTX nr result
ID: Sinomenium21_contig00034316
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00034316 (512 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283379.1| PREDICTED: uncharacterized protein LOC100267... 60 2e-07 emb|CAN60929.1| hypothetical protein VITISV_008358 [Vitis vinifera] 60 2e-07 ref|XP_007021867.1| Craniofacial development protein 1, putative... 58 2e-06 ref|XP_006360032.1| PREDICTED: uncharacterized protein LOC102580... 56 6e-06 >ref|XP_002283379.1| PREDICTED: uncharacterized protein LOC100267416 [Vitis vinifera] gi|302142872|emb|CBI20167.3| unnamed protein product [Vitis vinifera] Length = 330 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -2 Query: 511 NLADAMRVLTLYALNSVPIQLVVPDEVKDSVGKLLKEVVNLSE 383 NL+ MR+LTLYA+ S+P QLV+PDEVK SVG+LLKEV+ LSE Sbjct: 285 NLSVVMRLLTLYAMESMPPQLVLPDEVKASVGRLLKEVLRLSE 327 >emb|CAN60929.1| hypothetical protein VITISV_008358 [Vitis vinifera] Length = 330 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -2 Query: 511 NLADAMRVLTLYALNSVPIQLVVPDEVKDSVGKLLKEVVNLSE 383 NL+ MR+LTLYA+ S+P QLV+PDEVK SVG+LLKEV+ LSE Sbjct: 285 NLSVVMRLLTLYAMESMPPQLVLPDEVKASVGRLLKEVLRLSE 327 >ref|XP_007021867.1| Craniofacial development protein 1, putative isoform 1 [Theobroma cacao] gi|590610623|ref|XP_007021868.1| Craniofacial development protein 1, putative isoform 1 [Theobroma cacao] gi|508721495|gb|EOY13392.1| Craniofacial development protein 1, putative isoform 1 [Theobroma cacao] gi|508721496|gb|EOY13393.1| Craniofacial development protein 1, putative isoform 1 [Theobroma cacao] Length = 317 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -2 Query: 508 LADAMRVLTLYALNSVPIQLVVPDEVKDSVGKLLKEVVNLSE 383 L D M+V+ LYAL+ VP +L VPDEVKDSV +LLKEV+ LS+ Sbjct: 274 LVDVMKVIALYALDQVPPKLTVPDEVKDSVSRLLKEVIKLSQ 315 >ref|XP_006360032.1| PREDICTED: uncharacterized protein LOC102580802 isoform X1 [Solanum tuberosum] Length = 352 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = -2 Query: 511 NLADAMRVLTLYALNSVPIQLVVPDEVKDSVGKLLKEVVNLSE 383 +LA MRV+TLYAL SVP QLV+PDE+K SV +LL +++ LS+ Sbjct: 307 HLAGVMRVITLYALESVPPQLVIPDEIKASVSRLLMDILRLSQ 349