BLASTX nr result
ID: Sinomenium21_contig00034173
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00034173 (574 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006430131.1| hypothetical protein CICLE_v10012994mg [Citr... 57 3e-06 ref|XP_006836085.1| hypothetical protein AMTR_s00114p00125610 [A... 56 8e-06 >ref|XP_006430131.1| hypothetical protein CICLE_v10012994mg [Citrus clementina] gi|557532188|gb|ESR43371.1| hypothetical protein CICLE_v10012994mg [Citrus clementina] Length = 139 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +2 Query: 443 YFLKCHCHCHCHIAGLSFYTTEKYLAEAFSQFGQVVEAKIVMDR 574 Y + H C++AGLSFYT+ K L++AFSQ+GQVVEA IVMDR Sbjct: 17 YICRNHFCPLCYVAGLSFYTSNKGLSDAFSQYGQVVEANIVMDR 60 >ref|XP_006836085.1| hypothetical protein AMTR_s00114p00125610 [Amborella trichopoda] gi|548838507|gb|ERM98938.1| hypothetical protein AMTR_s00114p00125610 [Amborella trichopoda] Length = 135 Score = 55.8 bits (133), Expect = 8e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 479 IAGLSFYTTEKYLAEAFSQFGQVVEAKIVMDR 574 + GLSFYTTE L+EAFSQFGQV+EAKI+MDR Sbjct: 39 VGGLSFYTTENALSEAFSQFGQVIEAKIIMDR 70