BLASTX nr result
ID: Sinomenium21_contig00034139
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00034139 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB36980.1| hypothetical protein L484_018358 [Morus notabilis] 58 2e-06 >gb|EXB36980.1| hypothetical protein L484_018358 [Morus notabilis] Length = 601 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/67 (44%), Positives = 39/67 (58%), Gaps = 1/67 (1%) Frame = +2 Query: 128 GRGEKFCFWEDVRCGEPSFSTIFSIIGRLFLLHNKPISSFVA-EEEVNRSWNLHFLTSPK 304 G G + FWED GE S + FS + RL LHN+ ISSF + + SWN HF +P Sbjct: 262 GNGRRVRFWEDEWAGEESLAASFSNLFRLSNLHNQAISSFYSIGNDATISWNFHFRRNPS 321 Query: 305 EREMEEL 325 ERE+ E+ Sbjct: 322 ERELGEV 328