BLASTX nr result
ID: Sinomenium21_contig00034072
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00034072 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315642.2| hypothetical protein POPTR_0010s06290g, part... 69 5e-10 emb|CBM42563.1| putative B-type response regulator 21 [Populus x... 69 5e-10 ref|XP_002515016.1| two-component sensor histidine kinase bacter... 69 9e-10 gb|EXB82440.1| Two-component response regulator [Morus notabilis] 67 2e-09 emb|CBM42565.1| putative B-type response regulator 14 [Populus x... 67 2e-09 ref|XP_002312648.1| hypothetical protein POPTR_0008s18130g [Popu... 67 2e-09 ref|XP_004310019.1| PREDICTED: two-component response regulator ... 67 3e-09 ref|XP_004310018.1| PREDICTED: two-component response regulator ... 67 3e-09 ref|XP_007226956.1| hypothetical protein PRUPE_ppa002679mg [Prun... 67 3e-09 emb|CBI14873.3| unnamed protein product [Vitis vinifera] 66 6e-09 ref|XP_002274673.1| PREDICTED: two-component response regulator ... 66 6e-09 ref|XP_004142954.1| PREDICTED: two-component response regulator ... 65 7e-09 ref|XP_007044951.1| Two-component sensor histidine kinase bacter... 65 1e-08 ref|XP_007044950.1| Two-component sensor histidine kinase bacter... 65 1e-08 ref|XP_007044949.1| Two-component sensor histidine kinase bacter... 65 1e-08 ref|XP_006484016.1| PREDICTED: two-component response regulator ... 65 1e-08 ref|XP_006438147.1| hypothetical protein CICLE_v10031052mg [Citr... 65 1e-08 ref|XP_006580107.1| PREDICTED: two-component response regulator ... 64 3e-08 ref|XP_007158728.1| hypothetical protein PHAVU_002G177100g [Phas... 64 3e-08 ref|XP_003524159.1| PREDICTED: two-component response regulator ... 64 3e-08 >ref|XP_002315642.2| hypothetical protein POPTR_0010s06290g, partial [Populus trichocarpa] gi|550329203|gb|EEF01813.2| hypothetical protein POPTR_0010s06290g, partial [Populus trichocarpa] Length = 373 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/43 (76%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = +1 Query: 196 MENGVS-PRNNGFPAGLRVLVVDDDQVWLKVLERMLIKCSYEV 321 MENG S PRN+ FPAGLRVLVVDDD WLK+LE+ML +CSYEV Sbjct: 1 MENGFSSPRNDSFPAGLRVLVVDDDPTWLKILEKMLKRCSYEV 43 >emb|CBM42563.1| putative B-type response regulator 21 [Populus x canadensis] Length = 563 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/43 (76%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = +1 Query: 196 MENGVS-PRNNGFPAGLRVLVVDDDQVWLKVLERMLIKCSYEV 321 MENG S PRN+ FPAGLRVLVVDDD WLK+LE+ML +CSYEV Sbjct: 1 MENGFSSPRNDSFPAGLRVLVVDDDPTWLKILEKMLKRCSYEV 43 >ref|XP_002515016.1| two-component sensor histidine kinase bacteria, putative [Ricinus communis] gi|223546067|gb|EEF47570.1| two-component sensor histidine kinase bacteria, putative [Ricinus communis] Length = 584 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/43 (76%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = +1 Query: 196 MENGVS-PRNNGFPAGLRVLVVDDDQVWLKVLERMLIKCSYEV 321 MENG S PR++ FPAGLRVLVVDDD WLK+LE+ML KCSYEV Sbjct: 1 MENGFSSPRSDAFPAGLRVLVVDDDPTWLKILEKMLKKCSYEV 43 >gb|EXB82440.1| Two-component response regulator [Morus notabilis] Length = 576 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = +1 Query: 196 MENGVS-PRNNGFPAGLRVLVVDDDQVWLKVLERMLIKCSYEV 321 MENG S PR++ FPAGLRVLVVDDD WL++LE+ML KCSYEV Sbjct: 1 MENGFSSPRSDAFPAGLRVLVVDDDPTWLRILEKMLKKCSYEV 43 >emb|CBM42565.1| putative B-type response regulator 14 [Populus x canadensis] Length = 594 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/44 (75%), Positives = 36/44 (81%), Gaps = 2/44 (4%) Frame = +1 Query: 196 MENG--VSPRNNGFPAGLRVLVVDDDQVWLKVLERMLIKCSYEV 321 MEN SPRN+ FPAGLRVLVVDDD WLK+LE+ML KCSYEV Sbjct: 1 MENNGFSSPRNDSFPAGLRVLVVDDDPTWLKILEKMLKKCSYEV 44 >ref|XP_002312648.1| hypothetical protein POPTR_0008s18130g [Populus trichocarpa] gi|222852468|gb|EEE90015.1| hypothetical protein POPTR_0008s18130g [Populus trichocarpa] Length = 642 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/44 (75%), Positives = 36/44 (81%), Gaps = 2/44 (4%) Frame = +1 Query: 196 MENG--VSPRNNGFPAGLRVLVVDDDQVWLKVLERMLIKCSYEV 321 MEN SPRN+ FPAGLRVLVVDDD WLK+LE+ML KCSYEV Sbjct: 1 MENNGFSSPRNDSFPAGLRVLVVDDDPTWLKILEKMLKKCSYEV 44 >ref|XP_004310019.1| PREDICTED: two-component response regulator ARR11-like isoform 2 [Fragaria vesca subsp. vesca] Length = 577 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 211 SPRNNGFPAGLRVLVVDDDQVWLKVLERMLIKCSYEV 321 SPRN+ FPAGLRVLVVDDD WLK+LE+ML KCSYEV Sbjct: 7 SPRNDSFPAGLRVLVVDDDPTWLKILEKMLKKCSYEV 43 >ref|XP_004310018.1| PREDICTED: two-component response regulator ARR11-like isoform 1 [Fragaria vesca subsp. vesca] Length = 602 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 211 SPRNNGFPAGLRVLVVDDDQVWLKVLERMLIKCSYEV 321 SPRN+ FPAGLRVLVVDDD WLK+LE+ML KCSYEV Sbjct: 7 SPRNDSFPAGLRVLVVDDDPTWLKILEKMLKKCSYEV 43 >ref|XP_007226956.1| hypothetical protein PRUPE_ppa002679mg [Prunus persica] gi|462423892|gb|EMJ28155.1| hypothetical protein PRUPE_ppa002679mg [Prunus persica] Length = 645 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 211 SPRNNGFPAGLRVLVVDDDQVWLKVLERMLIKCSYEV 321 SPRN+ FPAGLRVLVVDDD WLK+LE+ML KCSYEV Sbjct: 7 SPRNDSFPAGLRVLVVDDDPTWLKILEKMLKKCSYEV 43 >emb|CBI14873.3| unnamed protein product [Vitis vinifera] Length = 592 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = +1 Query: 196 MENGV-SPRNNGFPAGLRVLVVDDDQVWLKVLERMLIKCSYEV 321 ME+G SPR FPAGLRVLVVDDD WLK+LE+ML KCSYEV Sbjct: 1 MESGFCSPRTEAFPAGLRVLVVDDDPTWLKILEKMLKKCSYEV 43 >ref|XP_002274673.1| PREDICTED: two-component response regulator ARR11 [Vitis vinifera] Length = 570 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = +1 Query: 196 MENGV-SPRNNGFPAGLRVLVVDDDQVWLKVLERMLIKCSYEV 321 ME+G SPR FPAGLRVLVVDDD WLK+LE+ML KCSYEV Sbjct: 1 MESGFCSPRTEAFPAGLRVLVVDDDPTWLKILEKMLKKCSYEV 43 >ref|XP_004142954.1| PREDICTED: two-component response regulator ARR11-like [Cucumis sativus] gi|449494494|ref|XP_004159561.1| PREDICTED: two-component response regulator ARR11-like [Cucumis sativus] Length = 583 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/43 (74%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = +1 Query: 196 MENGVS-PRNNGFPAGLRVLVVDDDQVWLKVLERMLIKCSYEV 321 MENG S PR++ FP GLRVLVVDDD WLK+LE+ML KCSYEV Sbjct: 1 MENGFSSPRSDVFPIGLRVLVVDDDPTWLKILEKMLKKCSYEV 43 >ref|XP_007044951.1| Two-component sensor histidine kinase bacteria, putative isoform 3 [Theobroma cacao] gi|508708886|gb|EOY00783.1| Two-component sensor histidine kinase bacteria, putative isoform 3 [Theobroma cacao] Length = 517 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 211 SPRNNGFPAGLRVLVVDDDQVWLKVLERMLIKCSYEV 321 SPR++ FPAGLRVLVVDDD WLK+LE+ML KCSYEV Sbjct: 8 SPRHDAFPAGLRVLVVDDDPTWLKILEKMLKKCSYEV 44 >ref|XP_007044950.1| Two-component sensor histidine kinase bacteria, putative isoform 2 [Theobroma cacao] gi|508708885|gb|EOY00782.1| Two-component sensor histidine kinase bacteria, putative isoform 2 [Theobroma cacao] Length = 440 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 211 SPRNNGFPAGLRVLVVDDDQVWLKVLERMLIKCSYEV 321 SPR++ FPAGLRVLVVDDD WLK+LE+ML KCSYEV Sbjct: 8 SPRHDAFPAGLRVLVVDDDPTWLKILEKMLKKCSYEV 44 >ref|XP_007044949.1| Two-component sensor histidine kinase bacteria, putative isoform 1 [Theobroma cacao] gi|508708884|gb|EOY00781.1| Two-component sensor histidine kinase bacteria, putative isoform 1 [Theobroma cacao] Length = 581 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 211 SPRNNGFPAGLRVLVVDDDQVWLKVLERMLIKCSYEV 321 SPR++ FPAGLRVLVVDDD WLK+LE+ML KCSYEV Sbjct: 8 SPRHDAFPAGLRVLVVDDDPTWLKILEKMLKKCSYEV 44 >ref|XP_006484016.1| PREDICTED: two-component response regulator ARR11-like isoform X1 [Citrus sinensis] gi|568861042|ref|XP_006484017.1| PREDICTED: two-component response regulator ARR11-like isoform X2 [Citrus sinensis] Length = 584 Score = 64.7 bits (156), Expect = 1e-08 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 2/44 (4%) Frame = +1 Query: 196 MENGVS-PRNNGF-PAGLRVLVVDDDQVWLKVLERMLIKCSYEV 321 MENG S PRN+ F PAGLRVLVVDDD WLK+LE+ML KCSYEV Sbjct: 1 MENGFSSPRNDTFNPAGLRVLVVDDDLAWLKILEKMLKKCSYEV 44 >ref|XP_006438147.1| hypothetical protein CICLE_v10031052mg [Citrus clementina] gi|557540343|gb|ESR51387.1| hypothetical protein CICLE_v10031052mg [Citrus clementina] Length = 584 Score = 64.7 bits (156), Expect = 1e-08 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 2/44 (4%) Frame = +1 Query: 196 MENGVS-PRNNGF-PAGLRVLVVDDDQVWLKVLERMLIKCSYEV 321 MENG S PRN+ F PAGLRVLVVDDD WLK+LE+ML KCSYEV Sbjct: 1 MENGFSSPRNDTFNPAGLRVLVVDDDLAWLKILEKMLKKCSYEV 44 >ref|XP_006580107.1| PREDICTED: two-component response regulator ARR11-like isoform X3 [Glycine max] Length = 583 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/44 (68%), Positives = 36/44 (81%), Gaps = 2/44 (4%) Frame = +1 Query: 196 MENGV--SPRNNGFPAGLRVLVVDDDQVWLKVLERMLIKCSYEV 321 M+NG SPR++ FPAGLRVLVVDDD WL++LE+ML KC YEV Sbjct: 1 MDNGCFSSPRHDAFPAGLRVLVVDDDPTWLRILEKMLKKCLYEV 44 >ref|XP_007158728.1| hypothetical protein PHAVU_002G177100g [Phaseolus vulgaris] gi|561032143|gb|ESW30722.1| hypothetical protein PHAVU_002G177100g [Phaseolus vulgaris] Length = 579 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/45 (66%), Positives = 36/45 (80%), Gaps = 2/45 (4%) Frame = +1 Query: 193 SMENGV--SPRNNGFPAGLRVLVVDDDQVWLKVLERMLIKCSYEV 321 +M+NG SPR+ FPAGLRVLVVDDD WL++LE+ML KC YEV Sbjct: 7 NMDNGCFSSPRHEAFPAGLRVLVVDDDPTWLRILEKMLKKCLYEV 51 >ref|XP_003524159.1| PREDICTED: two-component response regulator ARR11-like isoform X1 [Glycine max] gi|571455499|ref|XP_006580106.1| PREDICTED: two-component response regulator ARR11-like isoform X2 [Glycine max] Length = 584 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/44 (68%), Positives = 36/44 (81%), Gaps = 2/44 (4%) Frame = +1 Query: 196 MENGV--SPRNNGFPAGLRVLVVDDDQVWLKVLERMLIKCSYEV 321 M+NG SPR++ FPAGLRVLVVDDD WL++LE+ML KC YEV Sbjct: 1 MDNGCFSSPRHDAFPAGLRVLVVDDDPTWLRILEKMLKKCLYEV 44