BLASTX nr result
ID: Sinomenium21_contig00034024
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00034024 (427 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531688.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 >ref|XP_002531688.1| conserved hypothetical protein [Ricinus communis] gi|223528664|gb|EEF30679.1| conserved hypothetical protein [Ricinus communis] Length = 1391 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = +3 Query: 3 KDNPELSIVKDPSLSVETILMQLKNFPEAGKLMLTAVMLGKLGAETTEADGT 158 K+N E+S +K SVE +LMQ K+FP+AGKLMLTA+MLG + +T +GT Sbjct: 1336 KENSEVSALKGLDFSVEAVLMQHKDFPDAGKLMLTAIMLGSVHDDTKVEEGT 1387