BLASTX nr result
ID: Sinomenium21_contig00033791
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00033791 (669 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN76604.1| hypothetical protein VITISV_012933 [Vitis vinifera] 46 9e-06 >emb|CAN76604.1| hypothetical protein VITISV_012933 [Vitis vinifera] Length = 1863 Score = 45.8 bits (107), Expect(2) = 9e-06 Identities = 25/61 (40%), Positives = 32/61 (52%) Frame = -3 Query: 196 WKYTVHAIL*SV*LERNQRMFEDREHELGLVWDSIKFEASSWMSLFKQVQGVPGYDIFRD 17 W+ T A++ V ERN R+FED+ +WDSI F AS W K +G P I D Sbjct: 1797 WQATNIALIRIVWRERNARIFEDKARNSESLWDSIVFLASLWAYCSKVFKGTPLNAILLD 1856 Query: 16 W 14 W Sbjct: 1857 W 1857 Score = 30.0 bits (66), Expect(2) = 9e-06 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 14/51 (27%) Frame = -2 Query: 341 CVMCRNDGESADHLFWIACS--------------HSRVPPRHCLNILQSEF 231 C++C GESADH+F + CS VPPR L+++ +F Sbjct: 1735 CILCMKHGESADHIF-LHCSLTIGLWHRLFQLAKMDWVPPRSILDMMYIKF 1784