BLASTX nr result
ID: Sinomenium21_contig00033445
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00033445 (764 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006838835.1| hypothetical protein AMTR_s00002p00263570 [A... 75 2e-11 gb|EXB81315.1| hypothetical protein L484_005753 [Morus notabilis] 65 3e-08 ref|XP_007050389.1| Pentatricopeptide repeat-containing protein,... 57 7e-06 ref|XP_004292190.1| PREDICTED: pentatricopeptide repeat-containi... 57 9e-06 >ref|XP_006838835.1| hypothetical protein AMTR_s00002p00263570 [Amborella trichopoda] gi|548841341|gb|ERN01404.1| hypothetical protein AMTR_s00002p00263570 [Amborella trichopoda] Length = 646 Score = 75.5 bits (184), Expect = 2e-11 Identities = 36/82 (43%), Positives = 55/82 (67%) Frame = -1 Query: 764 QQVIQLLHKMMERGLLPDASTATIIIDFLSKNGQYHESLDLLPTFSPNHKQRGEMMNIES 585 ++ ++LLHKM ER +LPDASTA+I++D +S+N + LLP FSP Q G+ +N+ES Sbjct: 561 EKALELLHKMAERNVLPDASTASILVDLISENDHCGNFVKLLPRFSPK-SQEGDRLNVES 619 Query: 584 VISCFEDDFAFDQILGKVQHSE 519 +I+CF F + K+Q S+ Sbjct: 620 IIACFSGPFMCSANIHKLQCSD 641 >gb|EXB81315.1| hypothetical protein L484_005753 [Morus notabilis] Length = 549 Score = 65.1 bits (157), Expect = 3e-08 Identities = 29/60 (48%), Positives = 44/60 (73%) Frame = -1 Query: 761 QVIQLLHKMMERGLLPDASTATIIIDFLSKNGQYHESLDLLPTFSPNHKQRGEMMNIESV 582 +V++LLH+M +R + PDAST +I+ID +SK+ +Y E LDLLPTF K++ +M +SV Sbjct: 489 KVVELLHQMAKRNVQPDASTFSIVIDLVSKDKKYRECLDLLPTFPMQEKEKDDMFTFDSV 548 >ref|XP_007050389.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|590716300|ref|XP_007050390.1| RTE1 isoform 1 [Theobroma cacao] gi|590716304|ref|XP_007050391.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508702650|gb|EOX94546.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508702651|gb|EOX94547.1| RTE1 isoform 1 [Theobroma cacao] gi|508702652|gb|EOX94548.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 621 Score = 57.0 bits (136), Expect = 7e-06 Identities = 25/45 (55%), Positives = 36/45 (80%) Frame = -1 Query: 764 QQVIQLLHKMMERGLLPDASTATIIIDFLSKNGQYHESLDLLPTF 630 Q++++LL KM+E+ L PDAST + ++D LSK+ YHE+L LLPTF Sbjct: 571 QKMVELLQKMVEKKLSPDASTISAVVDLLSKDEAYHETLKLLPTF 615 >ref|XP_004292190.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 634 Score = 56.6 bits (135), Expect = 9e-06 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = -1 Query: 764 QQVIQLLHKMMERGLLPDASTATIIIDFLSKNGQYHESLDLLPTFS 627 ++V++LLHKM ER L PD ST +I+ID LSK+ Y + LD LP FS Sbjct: 579 EKVVELLHKMSERNLSPDISTTSIVIDLLSKDESYRKCLDWLPKFS 624