BLASTX nr result
ID: Sinomenium21_contig00033317
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00033317 (663 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN08556.1| Polyprotein, putative [Medicago truncatula] 61 4e-07 gb|ABD32695.2| RNA-binding region RNP-1 (RNA recognition motif);... 60 6e-07 gb|ABB00038.1| reverse transcriptase family member [Glycine max] 60 6e-07 ref|XP_003588515.1| hypothetical protein MTR_1g008050 [Medicago ... 60 8e-07 gb|EXB94379.1| E3 ubiquitin-protein ligase UPL6 [Morus notabilis] 59 1e-06 gb|EMS60091.1| Retinoblastoma-related protein 1 [Triticum urartu] 57 4e-06 >gb|ABN08556.1| Polyprotein, putative [Medicago truncatula] Length = 137 Score = 60.8 bits (146), Expect = 4e-07 Identities = 31/66 (46%), Positives = 44/66 (66%), Gaps = 1/66 (1%) Frame = +3 Query: 3 LYETKCWLVKRQNA-ELSAMEIQICR*MYGKTSKYRTKNE*IWKTVEVVPTAEKMSEN*L 179 LY T+CW VK Q+ ++S +E+++ R M GKT R +N+ I + V V P EK+ EN L Sbjct: 67 LYGTECWAVKSQHENQVSVVEMRMLRWMSGKTRHDRIRNDTIRERVGVAPIVEKLVENRL 126 Query: 180 RWFGHM 197 RWFGH+ Sbjct: 127 RWFGHV 132 >gb|ABD32695.2| RNA-binding region RNP-1 (RNA recognition motif); Calcium-binding EF-hand [Medicago truncatula] Length = 559 Score = 60.1 bits (144), Expect = 6e-07 Identities = 31/66 (46%), Positives = 43/66 (65%), Gaps = 1/66 (1%) Frame = +3 Query: 3 LYETKCWLVKRQNA-ELSAMEIQICR*MYGKTSKYRTKNE*IWKTVEVVPTAEKMSEN*L 179 LY T+CW VK Q+ ++S E+++ R M GKT R +N+ I + V V P EK+ EN L Sbjct: 289 LYGTECWAVKSQHENQVSVAEMRMLRWMSGKTRHDRIRNDTIRERVGVAPIVEKLVENRL 348 Query: 180 RWFGHM 197 RWFGH+ Sbjct: 349 RWFGHV 354 >gb|ABB00038.1| reverse transcriptase family member [Glycine max] Length = 377 Score = 60.1 bits (144), Expect = 6e-07 Identities = 31/66 (46%), Positives = 43/66 (65%), Gaps = 1/66 (1%) Frame = +3 Query: 3 LYETKCWLVKRQNA-ELSAMEIQICR*MYGKTSKYRTKNE*IWKTVEVVPTAEKMSEN*L 179 LY T+CW VK Q+ ++ E+++ R M GKT + + +NE I + V V P EKM EN L Sbjct: 247 LYGTECWAVKSQHENKVGVAEMRMLRWMCGKTRQDKIRNEAIRERVGVAPIVEKMVENRL 306 Query: 180 RWFGHM 197 RWFGH+ Sbjct: 307 RWFGHV 312 >ref|XP_003588515.1| hypothetical protein MTR_1g008050 [Medicago truncatula] gi|355477563|gb|AES58766.1| hypothetical protein MTR_1g008050 [Medicago truncatula] Length = 1675 Score = 59.7 bits (143), Expect = 8e-07 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 1/66 (1%) Frame = +3 Query: 3 LYETKCWLVKRQN-AELSAMEIQICR*MYGKTSKYRTKNE*IWKTVEVVPTAEKMSEN*L 179 LY T+CW+VK Q+ +++S E+++ R M GKT + R +N+ I + V V P EK+ EN L Sbjct: 1266 LYGTECWVVKSQHESKVSVAEMRMLRWMSGKTRQDRIRNDTIRERVGVAPIVEKLVENRL 1325 Query: 180 RWFGHM 197 RW GH+ Sbjct: 1326 RWLGHV 1331 >gb|EXB94379.1| E3 ubiquitin-protein ligase UPL6 [Morus notabilis] Length = 1413 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (1%) Frame = +3 Query: 3 LYETKCWLVKRQN-AELSAMEIQICR*MYGKTSKYRTKNE*IWKTVEVVPTAEKMSEN*L 179 LY +KCW +KRQ+ +++S E+++ R M G+T R KNE I V V P +K+ E L Sbjct: 968 LYGSKCWAIKRQHISKMSVAEMRMLRWMSGQTRMDRIKNEVIRSKVGVAPIEDKVREGRL 1027 Query: 180 RWFGHM 197 RWFGH+ Sbjct: 1028 RWFGHV 1033 >gb|EMS60091.1| Retinoblastoma-related protein 1 [Triticum urartu] Length = 747 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/66 (43%), Positives = 41/66 (62%), Gaps = 1/66 (1%) Frame = +3 Query: 3 LYETKCWLVKRQNAE-LSAMEIQICR*MYGKTSKYRTKNE*IWKTVEVVPTAEKMSEN*L 179 LY +CWL KR++ + L E+++ R M G T K R +N+ I V V P AEK+ + L Sbjct: 204 LYGAECWLTKRRHVQQLGVAEMRVLRWMCGHTRKDRVRNDDIRDRVGVAPIAEKLCPHRL 263 Query: 180 RWFGHM 197 RWFGH+ Sbjct: 264 RWFGHI 269