BLASTX nr result
ID: Sinomenium21_contig00033232
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00033232 (477 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512513.1| hypothetical protein RCOM_1435290 [Ricinus c... 57 4e-06 ref|XP_004302236.1| PREDICTED: RNA polymerase II-associated prot... 56 5e-06 >ref|XP_002512513.1| hypothetical protein RCOM_1435290 [Ricinus communis] gi|223548474|gb|EEF49965.1| hypothetical protein RCOM_1435290 [Ricinus communis] Length = 237 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = +1 Query: 1 LSAADKADLHKLWEEVFSNEAIPIECADTLSKLRAKYC 114 LSAADKADL KLW+EVF +EA PIE A+ L LR KYC Sbjct: 198 LSAADKADLLKLWDEVFCSEATPIEHAEILDNLRTKYC 235 >ref|XP_004302236.1| PREDICTED: RNA polymerase II-associated protein 3-like [Fragaria vesca subsp. vesca] Length = 407 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +1 Query: 1 LSAADKADLHKLWEEVFSNEAIPIECADTLSKLRAKYC 114 LS+ DKADL K+W+EVF NEA PIE A+ L LRAKYC Sbjct: 367 LSSNDKADLAKIWDEVFYNEATPIEFAEKLDNLRAKYC 404