BLASTX nr result
ID: Sinomenium21_contig00033039
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00033039 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB82664.1| Two-component response regulator [Morus notabilis] 96 4e-18 ref|XP_007223876.1| hypothetical protein PRUPE_ppa010863mg [Prun... 96 7e-18 ref|XP_007044474.1| Two-component response regulator ARR4 [Theob... 95 1e-17 ref|XP_006438504.1| hypothetical protein CICLE_v10032281mg [Citr... 93 3e-17 ref|XP_006438503.1| hypothetical protein CICLE_v10032281mg [Citr... 93 3e-17 ref|XP_006483757.1| PREDICTED: two-component response regulator ... 93 4e-17 gb|AFK41993.1| unknown [Lotus japonicus] 92 7e-17 ref|XP_002520201.1| two-component sensor protein histidine prote... 92 7e-17 ref|XP_004508816.1| PREDICTED: two-component response regulator ... 91 2e-16 ref|XP_002511471.1| two-component sensor protein histidine prote... 90 3e-16 ref|XP_007157523.1| hypothetical protein PHAVU_002G076900g [Phas... 90 3e-16 gb|EYU28654.1| hypothetical protein MIMGU_mgv1a012764mg [Mimulus... 90 4e-16 ref|XP_003519320.1| PREDICTED: two-component response regulator ... 90 4e-16 ref|XP_002892573.1| hypothetical protein ARALYDRAFT_888316 [Arab... 89 5e-16 ref|XP_003517746.1| PREDICTED: two-component response regulator ... 89 8e-16 emb|CBI32076.3| unnamed protein product [Vitis vinifera] 88 1e-15 emb|CAN69259.1| hypothetical protein VITISV_026384 [Vitis vinifera] 88 1e-15 gb|AAQ10675.1| type-A response regulator [Catharanthus roseus] 87 2e-15 ref|NP_172517.1| two-component response regulator ARR4 [Arabidop... 87 2e-15 gb|AGH13202.1| cytokinin response regulator 5 [Nicotiana attenuata] 87 3e-15 >gb|EXB82664.1| Two-component response regulator [Morus notabilis] Length = 239 Score = 96.3 bits (238), Expect = 4e-18 Identities = 54/90 (60%), Positives = 62/90 (68%) Frame = +3 Query: 81 MATDGAVSVMHMPEKIEGLEPLVTVDSQDLRVLEGFDSVPVDSHELHVLAVDDSLVDRKV 260 MA +G VS EK++G F+ PVDS E+HVLAVDDSLVDRKV Sbjct: 1 MARNGTVSWRRRSEKVDG-----------------FEFSPVDSEEVHVLAVDDSLVDRKV 43 Query: 261 IERLLKISSCKVTAVDSGRRALQYLGLDGE 350 IERLL+I+SCKVTAVDSGRRALQ+LGLD E Sbjct: 44 IERLLRITSCKVTAVDSGRRALQFLGLDEE 73 >ref|XP_007223876.1| hypothetical protein PRUPE_ppa010863mg [Prunus persica] gi|462420812|gb|EMJ25075.1| hypothetical protein PRUPE_ppa010863mg [Prunus persica] Length = 232 Score = 95.5 bits (236), Expect = 7e-18 Identities = 47/58 (81%), Positives = 53/58 (91%) Frame = +3 Query: 177 LEGFDSVPVDSHELHVLAVDDSLVDRKVIERLLKISSCKVTAVDSGRRALQYLGLDGE 350 L+GFD P++S E HVLAVDDSLVDRKVIERLL+ISSCKVTAVDSGRRALQ+LGLD + Sbjct: 16 LDGFDMSPMNSEEAHVLAVDDSLVDRKVIERLLRISSCKVTAVDSGRRALQFLGLDDD 73 >ref|XP_007044474.1| Two-component response regulator ARR4 [Theobroma cacao] gi|508708409|gb|EOY00306.1| Two-component response regulator ARR4 [Theobroma cacao] Length = 394 Score = 94.7 bits (234), Expect = 1e-17 Identities = 55/90 (61%), Positives = 61/90 (67%) Frame = +3 Query: 81 MATDGAVSVMHMPEKIEGLEPLVTVDSQDLRVLEGFDSVPVDSHELHVLAVDDSLVDRKV 260 MA +GAV+ EKI+G FD P DS E+HVLAVDDS VDRKV Sbjct: 158 MARNGAVTWRRRTEKIDG-----------------FDLSPSDSEEVHVLAVDDSHVDRKV 200 Query: 261 IERLLKISSCKVTAVDSGRRALQYLGLDGE 350 IERLL+ISSCKVTAVDSGRRALQ+LGLD E Sbjct: 201 IERLLRISSCKVTAVDSGRRALQFLGLDEE 230 >ref|XP_006438504.1| hypothetical protein CICLE_v10032281mg [Citrus clementina] gi|557540700|gb|ESR51744.1| hypothetical protein CICLE_v10032281mg [Citrus clementina] Length = 249 Score = 93.2 bits (230), Expect = 3e-17 Identities = 51/83 (61%), Positives = 61/83 (73%) Frame = +3 Query: 102 SVMHMPEKIEGLEPLVTVDSQDLRVLEGFDSVPVDSHELHVLAVDDSLVDRKVIERLLKI 281 +++H P G E ++ D ++GFD P D+ E+HVLAVDDS VDRKVIERLL I Sbjct: 16 TILHNPA---GTEHVLISDE-----IDGFDLSPSDTEEVHVLAVDDSFVDRKVIERLLTI 67 Query: 282 SSCKVTAVDSGRRALQYLGLDGE 350 SSCKVTAVDSGRRALQ+LGLD E Sbjct: 68 SSCKVTAVDSGRRALQFLGLDEE 90 >ref|XP_006438503.1| hypothetical protein CICLE_v10032281mg [Citrus clementina] gi|557540699|gb|ESR51743.1| hypothetical protein CICLE_v10032281mg [Citrus clementina] Length = 292 Score = 93.2 bits (230), Expect = 3e-17 Identities = 51/83 (61%), Positives = 61/83 (73%) Frame = +3 Query: 102 SVMHMPEKIEGLEPLVTVDSQDLRVLEGFDSVPVDSHELHVLAVDDSLVDRKVIERLLKI 281 +++H P G E ++ D ++GFD P D+ E+HVLAVDDS VDRKVIERLL I Sbjct: 16 TILHNPA---GTEHVLISDE-----IDGFDLSPSDTEEVHVLAVDDSFVDRKVIERLLTI 67 Query: 282 SSCKVTAVDSGRRALQYLGLDGE 350 SSCKVTAVDSGRRALQ+LGLD E Sbjct: 68 SSCKVTAVDSGRRALQFLGLDEE 90 >ref|XP_006483757.1| PREDICTED: two-component response regulator ARR4-like [Citrus sinensis] Length = 233 Score = 92.8 bits (229), Expect = 4e-17 Identities = 46/58 (79%), Positives = 51/58 (87%) Frame = +3 Query: 177 LEGFDSVPVDSHELHVLAVDDSLVDRKVIERLLKISSCKVTAVDSGRRALQYLGLDGE 350 ++GFD P D+ E+HVLAVDDS VDRKVIERLL ISSCKVTAVDSGRRALQ+LGLD E Sbjct: 17 IDGFDLSPSDTEEVHVLAVDDSFVDRKVIERLLTISSCKVTAVDSGRRALQFLGLDEE 74 >gb|AFK41993.1| unknown [Lotus japonicus] Length = 209 Score = 92.0 bits (227), Expect = 7e-17 Identities = 49/57 (85%), Positives = 49/57 (85%) Frame = +3 Query: 180 EGFDSVPVDSHELHVLAVDDSLVDRKVIERLLKISSCKVTAVDSGRRALQYLGLDGE 350 E F V DS ELHVLAVDDSLVDRKVIERLLKISSCKVT VDSG RALQYLGLDGE Sbjct: 8 EVFRRVLEDSDELHVLAVDDSLVDRKVIERLLKISSCKVTVVDSGTRALQYLGLDGE 64 >ref|XP_002520201.1| two-component sensor protein histidine protein kinase, putative [Ricinus communis] gi|223540693|gb|EEF42256.1| two-component sensor protein histidine protein kinase, putative [Ricinus communis] Length = 258 Score = 92.0 bits (227), Expect = 7e-17 Identities = 46/58 (79%), Positives = 52/58 (89%) Frame = +3 Query: 177 LEGFDSVPVDSHELHVLAVDDSLVDRKVIERLLKISSCKVTAVDSGRRALQYLGLDGE 350 +EGF+ D+ E+HVLAVDDSLVDRKVIERLLKI+SCKVTAVDSGRRALQ+LGLD E Sbjct: 16 IEGFEFSSCDNDEVHVLAVDDSLVDRKVIERLLKITSCKVTAVDSGRRALQFLGLDEE 73 >ref|XP_004508816.1| PREDICTED: two-component response regulator ARR5-like [Cicer arietinum] Length = 215 Score = 90.5 bits (223), Expect = 2e-16 Identities = 46/57 (80%), Positives = 49/57 (85%) Frame = +3 Query: 180 EGFDSVPVDSHELHVLAVDDSLVDRKVIERLLKISSCKVTAVDSGRRALQYLGLDGE 350 E D P + ELHVLAVDD+LVDRKVIERLLKISSCKVT V+SGRRALQYLGLDGE Sbjct: 14 ELLDESPSSADELHVLAVDDNLVDRKVIERLLKISSCKVTVVESGRRALQYLGLDGE 70 >ref|XP_002511471.1| two-component sensor protein histidine protein kinase, putative [Ricinus communis] gi|223550586|gb|EEF52073.1| two-component sensor protein histidine protein kinase, putative [Ricinus communis] Length = 221 Score = 90.1 bits (222), Expect = 3e-16 Identities = 46/48 (95%), Positives = 46/48 (95%) Frame = +3 Query: 207 SHELHVLAVDDSLVDRKVIERLLKISSCKVTAVDSGRRALQYLGLDGE 350 S ELHVLAVDDSLVDRKVIERLLKISSCKVTAVDSG RALQYLGLDGE Sbjct: 24 SEELHVLAVDDSLVDRKVIERLLKISSCKVTAVDSGTRALQYLGLDGE 71 >ref|XP_007157523.1| hypothetical protein PHAVU_002G076900g [Phaseolus vulgaris] gi|125658123|gb|ABN48988.1| type A response regulator RR1 [Phaseolus vulgaris] gi|561030938|gb|ESW29517.1| hypothetical protein PHAVU_002G076900g [Phaseolus vulgaris] Length = 227 Score = 90.1 bits (222), Expect = 3e-16 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 1/57 (1%) Frame = +3 Query: 177 LEGFDSV-PVDSHELHVLAVDDSLVDRKVIERLLKISSCKVTAVDSGRRALQYLGLD 344 L FD + P DSHE+HVLAVDDSLVDRKVIERLLKIS+CKVTAVDSG RALQ+LGLD Sbjct: 6 LVSFDHISPEDSHEVHVLAVDDSLVDRKVIERLLKISACKVTAVDSGIRALQFLGLD 62 >gb|EYU28654.1| hypothetical protein MIMGU_mgv1a012764mg [Mimulus guttatus] Length = 241 Score = 89.7 bits (221), Expect = 4e-16 Identities = 52/90 (57%), Positives = 63/90 (70%) Frame = +3 Query: 81 MATDGAVSVMHMPEKIEGLEPLVTVDSQDLRVLEGFDSVPVDSHELHVLAVDDSLVDRKV 260 M+ +G S + EK+EG VD + + + DS E+HVLAVDDSLVDRKV Sbjct: 1 MSKNGVFSRLRRLEKVEG------VDEYE------YANPSCDSDEVHVLAVDDSLVDRKV 48 Query: 261 IERLLKISSCKVTAVDSGRRALQYLGLDGE 350 IE+LLKI+SCKVTAVDSGRRALQ+LGLD E Sbjct: 49 IEKLLKITSCKVTAVDSGRRALQFLGLDEE 78 >ref|XP_003519320.1| PREDICTED: two-component response regulator ARR4-like [Glycine max] Length = 240 Score = 89.7 bits (221), Expect = 4e-16 Identities = 47/54 (87%), Positives = 50/54 (92%), Gaps = 1/54 (1%) Frame = +3 Query: 186 FDSV-PVDSHELHVLAVDDSLVDRKVIERLLKISSCKVTAVDSGRRALQYLGLD 344 FD V P DSHE+HVLAVDDSLVDRKVIERLLKIS+CKVTAVDSG RALQ+LGLD Sbjct: 9 FDHVSPEDSHEVHVLAVDDSLVDRKVIERLLKISACKVTAVDSGIRALQFLGLD 62 >ref|XP_002892573.1| hypothetical protein ARALYDRAFT_888316 [Arabidopsis lyrata subsp. lyrata] gi|297338415|gb|EFH68832.1| hypothetical protein ARALYDRAFT_888316 [Arabidopsis lyrata subsp. lyrata] Length = 258 Score = 89.4 bits (220), Expect = 5e-16 Identities = 50/90 (55%), Positives = 60/90 (66%) Frame = +3 Query: 81 MATDGAVSVMHMPEKIEGLEPLVTVDSQDLRVLEGFDSVPVDSHELHVLAVDDSLVDRKV 260 MA DG VS + M E + + G +S P+D E+HVLAVDDSLVDR V Sbjct: 1 MARDGGVSCLRMSEMMN---------------VGGIESAPLDLDEVHVLAVDDSLVDRIV 45 Query: 261 IERLLKISSCKVTAVDSGRRALQYLGLDGE 350 IERLL+I+SCKVTAVDSG RAL++LGLD E Sbjct: 46 IERLLRITSCKVTAVDSGWRALEFLGLDNE 75 >ref|XP_003517746.1| PREDICTED: two-component response regulator ARR4-like [Glycine max] Length = 244 Score = 88.6 bits (218), Expect = 8e-16 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +3 Query: 198 PVDSHELHVLAVDDSLVDRKVIERLLKISSCKVTAVDSGRRALQYLGLD 344 P DSHE+HVLAVDDSLVDRKVIERLLKIS+CKVTAVDSG RALQ+LGLD Sbjct: 14 PEDSHEVHVLAVDDSLVDRKVIERLLKISACKVTAVDSGIRALQFLGLD 62 >emb|CBI32076.3| unnamed protein product [Vitis vinifera] Length = 221 Score = 87.8 bits (216), Expect = 1e-15 Identities = 48/57 (84%), Positives = 49/57 (85%), Gaps = 1/57 (1%) Frame = +3 Query: 183 GFDSVPVDSHE-LHVLAVDDSLVDRKVIERLLKISSCKVTAVDSGRRALQYLGLDGE 350 GFD P S E HVLAVDDSLVDRKVIERLLKISSCKVTAVDSGRRALQ+LGLD E Sbjct: 18 GFDLSPGHSEEEAHVLAVDDSLVDRKVIERLLKISSCKVTAVDSGRRALQFLGLDEE 74 >emb|CAN69259.1| hypothetical protein VITISV_026384 [Vitis vinifera] Length = 210 Score = 87.8 bits (216), Expect = 1e-15 Identities = 48/57 (84%), Positives = 49/57 (85%), Gaps = 1/57 (1%) Frame = +3 Query: 183 GFDSVPVDSHE-LHVLAVDDSLVDRKVIERLLKISSCKVTAVDSGRRALQYLGLDGE 350 GFD P S E HVLAVDDSLVDRKVIERLLKISSCKVTAVDSGRRALQ+LGLD E Sbjct: 7 GFDLSPGHSEEEAHVLAVDDSLVDRKVIERLLKISSCKVTAVDSGRRALQFLGLDEE 63 >gb|AAQ10675.1| type-A response regulator [Catharanthus roseus] Length = 254 Score = 87.4 bits (215), Expect = 2e-15 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = +3 Query: 213 ELHVLAVDDSLVDRKVIERLLKISSCKVTAVDSGRRALQYLGLDGE 350 ELHVLAVDDSLVDRKVIERLLKIS CKVTAV+SGRRALQYLGLDGE Sbjct: 13 ELHVLAVDDSLVDRKVIERLLKISCCKVTAVESGRRALQYLGLDGE 58 >ref|NP_172517.1| two-component response regulator ARR4 [Arabidopsis thaliana] gi|51315817|sp|O82798.1|ARR4_ARATH RecName: Full=Two-component response regulator ARR4; AltName: Full=Response regulator 1 gi|5091539|gb|AAD39568.1|AC007067_8 T10O24.8 [Arabidopsis thaliana] gi|3273196|dbj|BAA31143.1| responce regulator1 [Arabidopsis thaliana] gi|3323583|gb|AAC26636.1| two-component response regulator homolog [Arabidopsis thaliana] gi|3953597|dbj|BAA34726.1| response regulator 4 [Arabidopsis thaliana] gi|87116590|gb|ABD19659.1| At1g10470 [Arabidopsis thaliana] gi|110740750|dbj|BAE98474.1| putative response regulator 3 [Arabidopsis thaliana] gi|332190462|gb|AEE28583.1| two-component response regulator ARR4 [Arabidopsis thaliana] Length = 259 Score = 87.0 bits (214), Expect = 2e-15 Identities = 49/90 (54%), Positives = 60/90 (66%) Frame = +3 Query: 81 MATDGAVSVMHMPEKIEGLEPLVTVDSQDLRVLEGFDSVPVDSHELHVLAVDDSLVDRKV 260 MA DG VS + E + + + G +S P+D E+HVLAVDDSLVDR V Sbjct: 1 MARDGGVSCLRRSEMMS------------VGGIGGIESAPLDLDEVHVLAVDDSLVDRIV 48 Query: 261 IERLLKISSCKVTAVDSGRRALQYLGLDGE 350 IERLL+I+SCKVTAVDSG RAL++LGLD E Sbjct: 49 IERLLRITSCKVTAVDSGWRALEFLGLDNE 78 >gb|AGH13202.1| cytokinin response regulator 5 [Nicotiana attenuata] Length = 201 Score = 86.7 bits (213), Expect = 3e-15 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = +3 Query: 213 ELHVLAVDDSLVDRKVIERLLKISSCKVTAVDSGRRALQYLGLDGE 350 ELHVLAVDDS VDRKVIERLLKISSCKVTAV+SGRRALQYLGLDGE Sbjct: 7 ELHVLAVDDSHVDRKVIERLLKISSCKVTAVESGRRALQYLGLDGE 52