BLASTX nr result
ID: Sinomenium21_contig00032887
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00032887 (359 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004511758.1| PREDICTED: regulator of nonsense transcripts... 60 3e-07 >ref|XP_004511758.1| PREDICTED: regulator of nonsense transcripts 1 homolog isoform X1 [Cicer arietinum] Length = 1261 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/44 (63%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = -2 Query: 358 QDFLGDDFKSQGSHVAYNVSDFSTQV-HLTFLTIYHDVYVTFHI 230 QDFLGDDFKSQGSHV YNV+DFSTQV L +L +Y +++F + Sbjct: 1111 QDFLGDDFKSQGSHVPYNVTDFSTQVCELLWLILYFSFFISFSL 1154