BLASTX nr result
ID: Sinomenium21_contig00032817
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00032817 (404 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007050407.1| DREB2A-interacting protein 2 isoform 1 [Theo... 60 3e-07 gb|EXB81323.1| E3 ubiquitin protein ligase DRIP2 [Morus notabilis] 58 2e-06 ref|XP_006443904.1| hypothetical protein CICLE_v10020170mg [Citr... 57 2e-06 ref|XP_002315733.2| hypothetical protein POPTR_0010s08840g, part... 57 3e-06 ref|XP_004289907.1| PREDICTED: E3 ubiquitin protein ligase DRIP2... 57 3e-06 ref|XP_007162503.1| hypothetical protein PHAVU_001G157400g [Phas... 56 4e-06 ref|XP_002275598.1| PREDICTED: E3 ubiquitin protein ligase DRIP2... 56 4e-06 ref|XP_003520583.1| PREDICTED: E3 ubiquitin protein ligase DRIP2... 56 6e-06 ref|XP_006424010.1| hypothetical protein CICLE_v10028433mg [Citr... 55 8e-06 ref|XP_006375840.1| hypothetical protein POPTR_0013s03930g [Popu... 55 8e-06 ref|XP_002319079.2| hypothetical protein POPTR_0013s03930g [Popu... 55 8e-06 ref|XP_007030547.1| DREB2A-interacting protein 2 isoform 2 [Theo... 55 1e-05 ref|XP_007030546.1| DREB2A-interacting protein 2 isoform 1 [Theo... 55 1e-05 gb|AEY75223.2| putative E3 ubiquitin protein ligase DRIP2 [Vigna... 55 1e-05 >ref|XP_007050407.1| DREB2A-interacting protein 2 isoform 1 [Theobroma cacao] gi|508702668|gb|EOX94564.1| DREB2A-interacting protein 2 isoform 1 [Theobroma cacao] Length = 429 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +2 Query: 2 LVDLWLQTASTSQRVSACVGTPAKDFVMVLAYGRKV 109 LVDLWLQTASTSQRV A VG+ AKDFVMVL Y RK+ Sbjct: 391 LVDLWLQTASTSQRVPASVGSSAKDFVMVLGYARKI 426 >gb|EXB81323.1| E3 ubiquitin protein ligase DRIP2 [Morus notabilis] Length = 432 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +2 Query: 2 LVDLWLQTASTSQRVSACVGTPAKDFVMVLAYGRKVQPS 118 LVDLWLQTASTS+R+ A +G+ AKDFVMVL Y RK S Sbjct: 394 LVDLWLQTASTSERIPATIGSSAKDFVMVLVYARKAPES 432 >ref|XP_006443904.1| hypothetical protein CICLE_v10020170mg [Citrus clementina] gi|567902834|ref|XP_006443905.1| hypothetical protein CICLE_v10020170mg [Citrus clementina] gi|568851817|ref|XP_006479583.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X1 [Citrus sinensis] gi|568851819|ref|XP_006479584.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X2 [Citrus sinensis] gi|557546166|gb|ESR57144.1| hypothetical protein CICLE_v10020170mg [Citrus clementina] gi|557546167|gb|ESR57145.1| hypothetical protein CICLE_v10020170mg [Citrus clementina] Length = 441 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +2 Query: 2 LVDLWLQTASTSQRVSACVGTPAKDFVMVLAYGRKVQ 112 LVDLWLQTA+TS RV A +G+ AKDFVMVL Y RKV+ Sbjct: 402 LVDLWLQTAATSDRVPAMIGSSAKDFVMVLTYARKVR 438 >ref|XP_002315733.2| hypothetical protein POPTR_0010s08840g, partial [Populus trichocarpa] gi|550329396|gb|EEF01904.2| hypothetical protein POPTR_0010s08840g, partial [Populus trichocarpa] Length = 445 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +2 Query: 2 LVDLWLQTASTSQRVSACVGTPAKDFVMVLAYGRKVQP 115 LVD WLQTAS S+R+ VG+ AKDFVMVL+YGRK P Sbjct: 407 LVDWWLQTASASERIRTTVGSSAKDFVMVLSYGRKAHP 444 >ref|XP_004289907.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Fragaria vesca subsp. vesca] Length = 426 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +2 Query: 2 LVDLWLQTASTSQRVSACVGTPAKDFVMVLAYGRKVQPS 118 LVDLWLQTAS +QR+ A +G+ AKDFVMVL Y RK+ S Sbjct: 388 LVDLWLQTASPTQRIPASIGSSAKDFVMVLGYSRKISKS 426 >ref|XP_007162503.1| hypothetical protein PHAVU_001G157400g [Phaseolus vulgaris] gi|561035967|gb|ESW34497.1| hypothetical protein PHAVU_001G157400g [Phaseolus vulgaris] Length = 429 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +2 Query: 2 LVDLWLQTASTSQRVSACVGTPAKDFVMVLAYGRK 106 LV+LWL TASTSQR+ A +G+ AKDFVMVLAY RK Sbjct: 391 LVELWLDTASTSQRIPATIGSSAKDFVMVLAYARK 425 >ref|XP_002275598.1| PREDICTED: E3 ubiquitin protein ligase DRIP2 [Vitis vinifera] gi|297735508|emb|CBI17948.3| unnamed protein product [Vitis vinifera] Length = 430 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 2 LVDLWLQTASTSQRVSACVGTPAKDFVMVLAYGRKV 109 LVDLWLQTASTSQRV A +G+ K+FVMVLAY R++ Sbjct: 392 LVDLWLQTASTSQRVPASIGSSGKEFVMVLAYARRL 427 >ref|XP_003520583.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Glycine max] Length = 445 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 2 LVDLWLQTASTSQRVSACVGTPAKDFVMVLAYGRKV 109 LV+LWL AST QR+ A +G+ AKDFVMVLAYGRKV Sbjct: 407 LVELWLDMASTPQRIPATIGSSAKDFVMVLAYGRKV 442 >ref|XP_006424010.1| hypothetical protein CICLE_v10028433mg [Citrus clementina] gi|557525944|gb|ESR37250.1| hypothetical protein CICLE_v10028433mg [Citrus clementina] Length = 448 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 2 LVDLWLQTASTSQRVSACVGTPAKDFVMVLAYGRKVQPS 118 LVDLW TASTS++V A VG+ AKDFVMVL+Y RKVQ S Sbjct: 410 LVDLWFCTASTSKKVPASVGSSAKDFVMVLSYCRKVQAS 448 >ref|XP_006375840.1| hypothetical protein POPTR_0013s03930g [Populus trichocarpa] gi|550324905|gb|ERP53637.1| hypothetical protein POPTR_0013s03930g [Populus trichocarpa] Length = 448 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +2 Query: 2 LVDLWLQTASTSQRVSACVGTPAKDFVMVLAYGRKVQPS 118 LVDLW +T STS++V A VG+ AKDFVMVL+Y RKVQ S Sbjct: 410 LVDLWFRTGSTSKKVPASVGSSAKDFVMVLSYCRKVQES 448 >ref|XP_002319079.2| hypothetical protein POPTR_0013s03930g [Populus trichocarpa] gi|550324904|gb|EEE95002.2| hypothetical protein POPTR_0013s03930g [Populus trichocarpa] Length = 430 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +2 Query: 2 LVDLWLQTASTSQRVSACVGTPAKDFVMVLAYGRKVQPS 118 LVDLW +T STS++V A VG+ AKDFVMVL+Y RKVQ S Sbjct: 392 LVDLWFRTGSTSKKVPASVGSSAKDFVMVLSYCRKVQES 430 >ref|XP_007030547.1| DREB2A-interacting protein 2 isoform 2 [Theobroma cacao] gi|508719152|gb|EOY11049.1| DREB2A-interacting protein 2 isoform 2 [Theobroma cacao] Length = 460 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +2 Query: 2 LVDLWLQTASTSQRVSACVGTPAKDFVMVLAYGRKVQ 112 LVDLW +TAST+++V A VG+ AKDFVMVL+Y RKVQ Sbjct: 422 LVDLWFRTASTAKKVPASVGSSAKDFVMVLSYRRKVQ 458 >ref|XP_007030546.1| DREB2A-interacting protein 2 isoform 1 [Theobroma cacao] gi|508719151|gb|EOY11048.1| DREB2A-interacting protein 2 isoform 1 [Theobroma cacao] Length = 450 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +2 Query: 2 LVDLWLQTASTSQRVSACVGTPAKDFVMVLAYGRKVQ 112 LVDLW +TAST+++V A VG+ AKDFVMVL+Y RKVQ Sbjct: 412 LVDLWFRTASTAKKVPASVGSSAKDFVMVLSYRRKVQ 448 >gb|AEY75223.2| putative E3 ubiquitin protein ligase DRIP2 [Vigna unguiculata] Length = 433 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = +2 Query: 2 LVDLWLQTASTSQRVSACVGTPAKDFVMVLAYGRKVQ 112 LV+LWL TAST R+ A +G+ KDFVM+L YGRKVQ Sbjct: 393 LVELWLDTASTGHRIPATIGSSGKDFVMILTYGRKVQ 429