BLASTX nr result
ID: Sinomenium21_contig00032391
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00032391 (428 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269977.2| PREDICTED: histidine kinase 2-like [Vitis vi... 68 1e-09 >ref|XP_002269977.2| PREDICTED: histidine kinase 2-like [Vitis vinifera] Length = 1272 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = +2 Query: 278 MSFSAVAGVFLKLPRLFLKICWWVLVRMAVNCKISAFQSRLSVNNKKQR 424 MSFSAVAGVFLKL RL LKIC WVL++M++NCK+S F RL N K ++ Sbjct: 1 MSFSAVAGVFLKLSRLILKICRWVLLKMSLNCKLSGFSGRLPANLKLKK 49