BLASTX nr result
ID: Sinomenium21_contig00032325
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00032325 (752 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006858678.1| hypothetical protein AMTR_s00066p00081840 [A... 118 3e-24 ref|XP_006858679.1| hypothetical protein AMTR_s00066p00082400 [A... 117 6e-24 ref|XP_002268526.2| PREDICTED: pentatricopeptide repeat-containi... 111 2e-22 ref|XP_003571953.1| PREDICTED: pentatricopeptide repeat-containi... 90 7e-16 ref|XP_007038409.1| Tetratricopeptide repeat-like superfamily pr... 88 4e-15 gb|EEC66478.1| hypothetical protein OsI_32564 [Oryza sativa Indi... 82 2e-13 gb|EAZ15116.1| hypothetical protein OsJ_30529 [Oryza sativa Japo... 82 2e-13 ref|XP_006490098.1| PREDICTED: pentatricopeptide repeat-containi... 81 4e-13 ref|XP_006662144.1| PREDICTED: pentatricopeptide repeat-containi... 79 2e-12 ref|XP_006421694.1| hypothetical protein CICLE_v10004237mg [Citr... 78 3e-12 ref|XP_002975593.1| hypothetical protein SELMODRAFT_103638 [Sela... 67 9e-09 ref|XP_006358268.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 gb|AFV61021.1| pentatricopeptide repeat-containing protein 11, p... 66 1e-08 gb|ACU25582.1| pentatricopeptide repeat-containing protein [Phyl... 66 1e-08 ref|XP_006384788.1| hypothetical protein POPTR_0004s21110g [Popu... 65 2e-08 gb|AFV61049.1| pentatricopeptide repeat-containing protein 11, p... 65 3e-08 gb|AFV61035.1| pentatricopeptide repeat-containing protein 11, p... 65 3e-08 gb|AFV61054.1| pentatricopeptide repeat-containing protein 11, p... 64 4e-08 gb|AFV61053.1| pentatricopeptide repeat-containing protein 11, p... 64 4e-08 gb|AFV61025.1| pentatricopeptide repeat-containing protein 11, p... 64 4e-08 >ref|XP_006858678.1| hypothetical protein AMTR_s00066p00081840 [Amborella trichopoda] gi|548862789|gb|ERN20145.1| hypothetical protein AMTR_s00066p00081840 [Amborella trichopoda] Length = 992 Score = 118 bits (295), Expect = 3e-24 Identities = 53/107 (49%), Positives = 76/107 (71%) Frame = +1 Query: 1 RGLFPSKVSYERLLKSLCFSCSSDLAFKIFEEMLFHDYVPCNHNCNLLLSTLCQGNTLNE 180 +G PSK+SY+RLL+ L + + DLAF +F+EML H PC +N N L+ C+ N L E Sbjct: 885 KGFVPSKISYDRLLEHLSVNGAIDLAFNLFQEMLMHGCAPCRYNFNRLICLFCEENRLRE 944 Query: 181 AYEVYDMIFKRGKTPDKEIKRLLVEACYKQGDYDLAIMLEENILVYE 321 A+ V+D + KRGK P++ K L+EACY Q ++++AIM+EEN+LVYE Sbjct: 945 AHFVFDAMLKRGKLPEESTKTQLIEACYMQREFEMAIMIEENMLVYE 991 >ref|XP_006858679.1| hypothetical protein AMTR_s00066p00082400 [Amborella trichopoda] gi|548862790|gb|ERN20146.1| hypothetical protein AMTR_s00066p00082400 [Amborella trichopoda] Length = 992 Score = 117 bits (292), Expect = 6e-24 Identities = 53/107 (49%), Positives = 75/107 (70%) Frame = +1 Query: 1 RGLFPSKVSYERLLKSLCFSCSSDLAFKIFEEMLFHDYVPCNHNCNLLLSTLCQGNTLNE 180 +G P+K+SYERLL L + + DLAF +F+EML H PC +N N L+ LC+ N L E Sbjct: 885 KGFVPNKISYERLLDLLSVNGAIDLAFNLFQEMLMHGCAPCKYNFNRLICLLCEENRLRE 944 Query: 181 AYEVYDMIFKRGKTPDKEIKRLLVEACYKQGDYDLAIMLEENILVYE 321 A+ V+D + KRGK P++ K L+EACY Q ++++A M+EEN+LVYE Sbjct: 945 AHFVFDAMLKRGKLPEESTKTQLIEACYMQREFEMAFMIEENMLVYE 991 >ref|XP_002268526.2| PREDICTED: pentatricopeptide repeat-containing protein At5g62370-like [Vitis vinifera] Length = 1101 Score = 111 bits (278), Expect = 2e-22 Identities = 59/103 (57%), Positives = 73/103 (70%) Frame = +1 Query: 1 RGLFPSKVSYERLLKSLCFSCSSDLAFKIFEEMLFHDYVPCNHNCNLLLSTLCQGNTLNE 180 RGLFP+K SYE+LLK LC S AFKIFEEML HDYVPC +NCN LL LC+ + +E Sbjct: 904 RGLFPNKSSYEKLLKCLCASHLGVHAFKIFEEMLSHDYVPCWYNCNWLLCILCEEHRWHE 963 Query: 181 AYEVYDMIFKRGKTPDKEIKRLLVEACYKQGDYDLAIMLEENI 309 A+ V+D++ K+ K PD+ KRLLVEAC K+ M+EENI Sbjct: 964 AHIVFDVMLKQRKYPDELTKRLLVEACNKK-----IFMIEENI 1001 >ref|XP_003571953.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370-like [Brachypodium distachyon] Length = 926 Score = 90.1 bits (222), Expect = 7e-16 Identities = 44/106 (41%), Positives = 66/106 (62%) Frame = +1 Query: 1 RGLFPSKVSYERLLKSLCFSCSSDLAFKIFEEMLFHDYVPCNHNCNLLLSTLCQGNTLNE 180 RG PSK +Y+++++ L S+DLA IF++M H Y+P N + LL L + N E Sbjct: 818 RGFVPSKAAYDKIMEQLLAENSTDLALNIFDDMFCHGYIPRYSNYSSLLLVLAKDNQWRE 877 Query: 181 AYEVYDMIFKRGKTPDKEIKRLLVEACYKQGDYDLAIMLEENILVY 318 V+ M+ ++G++ D E K+LL E CYKQG+ DLA LE N+ +Y Sbjct: 878 VDRVFMMMLEKGRSLDTETKKLLEELCYKQGELDLAFELEGNMPLY 923 >ref|XP_007038409.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590671720|ref|XP_007038410.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590671723|ref|XP_007038411.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508775654|gb|EOY22910.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508775655|gb|EOY22911.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508775656|gb|EOY22912.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 1003 Score = 87.8 bits (216), Expect = 4e-15 Identities = 47/101 (46%), Positives = 60/101 (59%) Frame = +1 Query: 1 RGLFPSKVSYERLLKSLCFSCSSDLAFKIFEEMLFHDYVPCNHNCNLLLSTLCQGNTLNE 180 RGL P K +YE LL C S AFKIFEEML + VP ++ N LL LC+ L E Sbjct: 899 RGLIPRKATYENLLAHFCASYLCIPAFKIFEEMLASNVVPRPYSYNWLLCILCEQKKLRE 958 Query: 181 AYEVYDMIFKRGKTPDKEIKRLLVEACYKQGDYDLAIMLEE 303 AY V+D + +RGK P K +RLL E KQG+ D M+++ Sbjct: 959 AYIVFDTMIQRGKYPLKSTERLLAETLRKQGECDFGFMIQD 999 >gb|EEC66478.1| hypothetical protein OsI_32564 [Oryza sativa Indica Group] Length = 481 Score = 82.4 bits (202), Expect = 2e-13 Identities = 41/106 (38%), Positives = 63/106 (59%) Frame = +1 Query: 1 RGLFPSKVSYERLLKSLCFSCSSDLAFKIFEEMLFHDYVPCNHNCNLLLSTLCQGNTLNE 180 RG PSK SY++L++ L + D+ ++FE+MLF Y P N LL L + +E Sbjct: 373 RGFVPSKASYDKLMELLLAENAIDIVLQLFEDMLFQGYTPRYANYTSLLLVLAKDGRWSE 432 Query: 181 AYEVYDMIFKRGKTPDKEIKRLLVEACYKQGDYDLAIMLEENILVY 318 A ++ M+ K+ K DK+ K+ L E CYKQG+ DLA +E ++ +Y Sbjct: 433 ADRIFTMMLKKRKYLDKKTKKCLEELCYKQGELDLAFEMEGSVPLY 478 >gb|EAZ15116.1| hypothetical protein OsJ_30529 [Oryza sativa Japonica Group] Length = 906 Score = 82.4 bits (202), Expect = 2e-13 Identities = 41/106 (38%), Positives = 63/106 (59%) Frame = +1 Query: 1 RGLFPSKVSYERLLKSLCFSCSSDLAFKIFEEMLFHDYVPCNHNCNLLLSTLCQGNTLNE 180 RG PSK SY++L++ L + D+ ++FE+MLF Y P N LL L + +E Sbjct: 798 RGFVPSKASYDKLMELLLAENAIDIVLQLFEDMLFQGYTPRYANYTSLLLVLAKDGRWSE 857 Query: 181 AYEVYDMIFKRGKTPDKEIKRLLVEACYKQGDYDLAIMLEENILVY 318 A ++ M+ K+ K DK+ K+ L E CYKQG+ DLA +E ++ +Y Sbjct: 858 ADRIFTMMLKKRKYLDKKTKKCLEELCYKQGELDLAFEMEGSVPLY 903 >ref|XP_006490098.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370-like isoform X1 [Citrus sinensis] gi|568873973|ref|XP_006490099.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370-like isoform X2 [Citrus sinensis] gi|568873975|ref|XP_006490100.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370-like isoform X3 [Citrus sinensis] Length = 1004 Score = 80.9 bits (198), Expect = 4e-13 Identities = 37/75 (49%), Positives = 49/75 (65%) Frame = +1 Query: 1 RGLFPSKVSYERLLKSLCFSCSSDLAFKIFEEMLFHDYVPCNHNCNLLLSTLCQGNTLNE 180 RG P K +YE LL+ C +C S AF +F+EM+ HD+VPC NCN LL+ LCQ +E Sbjct: 910 RGFVPKKATYEHLLECFCANCLSIPAFNMFKEMIVHDHVPCLSNCNWLLNILCQEKHFHE 969 Query: 181 AYEVYDMIFKRGKTP 225 A V D++ KRG+ P Sbjct: 970 AQIVLDVMHKRGRLP 984 >ref|XP_006662144.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370-like, partial [Oryza brachyantha] Length = 852 Score = 78.6 bits (192), Expect = 2e-12 Identities = 40/106 (37%), Positives = 60/106 (56%) Frame = +1 Query: 1 RGLFPSKVSYERLLKSLCFSCSSDLAFKIFEEMLFHDYVPCNHNCNLLLSTLCQGNTLNE 180 RG PSK SY++L++ L DL ++FE M Y P N LL L + +E Sbjct: 744 RGFVPSKASYDKLIELLLTENEIDLVIQLFENMFVQGYTPRYFNYTSLLLVLAKDGRWSE 803 Query: 181 AYEVYDMIFKRGKTPDKEIKRLLVEACYKQGDYDLAIMLEENILVY 318 A +++ M+ K+G+ D E K+ L E CYKQG+ DLA +E ++ +Y Sbjct: 804 ADKIFRMMLKKGRYLDTETKKCLEEQCYKQGELDLAFEMEGSMPLY 849 >ref|XP_006421694.1| hypothetical protein CICLE_v10004237mg [Citrus clementina] gi|557523567|gb|ESR34934.1| hypothetical protein CICLE_v10004237mg [Citrus clementina] Length = 1004 Score = 77.8 bits (190), Expect(2) = 3e-12 Identities = 37/80 (46%), Positives = 50/80 (62%) Frame = +1 Query: 1 RGLFPSKVSYERLLKSLCFSCSSDLAFKIFEEMLFHDYVPCNHNCNLLLSTLCQGNTLNE 180 RG P K +YE LL+ C +C S AF +F+EM+ HD+VPC NCN LL+ L Q +E Sbjct: 910 RGFVPKKATYEHLLECFCANCLSIPAFNMFKEMIVHDHVPCLSNCNWLLNILFQEKHFHE 969 Query: 181 AYEVYDMIFKRGKTPDKEIK 240 A V D++ KRG+ P K + Sbjct: 970 AQIVLDVMHKRGRLPCKSTR 989 Score = 20.8 bits (42), Expect(2) = 3e-12 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +2 Query: 218 KLQTKR*RDYWWKHVISRE 274 +L K R +W KH I +E Sbjct: 982 RLPCKSTRGFWRKHFIGKE 1000 >ref|XP_002975593.1| hypothetical protein SELMODRAFT_103638 [Selaginella moellendorffii] gi|300156594|gb|EFJ23222.1| hypothetical protein SELMODRAFT_103638 [Selaginella moellendorffii] Length = 471 Score = 66.6 bits (161), Expect = 9e-09 Identities = 36/104 (34%), Positives = 59/104 (56%) Frame = +1 Query: 1 RGLFPSKVSYERLLKSLCFSCSSDLAFKIFEEMLFHDYVPCNHNCNLLLSTLCQGNTLNE 180 RG + V+Y L+ LC + + A+K+ EEM YVP N N +LS LC+ ++E Sbjct: 143 RGCSANTVAYNALINGLCKDENIERAYKLLEEMASKGYVPDNITYNTILSGLCRMGKVSE 202 Query: 181 AYEVYDMIFKRGKTPDKEIKRLLVEACYKQGDYDLAIMLEENIL 312 A + +D + RG +PD L++A YK+G D A+ L ++++ Sbjct: 203 AKQFFDSMPSRGYSPDVVAYNGLLDALYKEGKTDEAMKLFKDVI 246 >ref|XP_006358268.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370-like [Solanum tuberosum] Length = 1067 Score = 66.2 bits (160), Expect = 1e-08 Identities = 35/73 (47%), Positives = 45/73 (61%) Frame = +1 Query: 1 RGLFPSKVSYERLLKSLCFSCSSDLAFKIFEEMLFHDYVPCNHNCNLLLSTLCQGNTLNE 180 +GL PSK SYE LL SLC S A KI +ML + YVPC HN LL+ L + N +E Sbjct: 907 KGLAPSKASYESLLSSLCASNWRVHALKICHDMLANKYVPCGHNLKLLICILGEENKWHE 966 Query: 181 AYEVYDMIFKRGK 219 A +YD++ K+ K Sbjct: 967 ARFMYDLLLKKEK 979 >gb|AFV61021.1| pentatricopeptide repeat-containing protein 11, partial [Burroughsia fastigiata] Length = 431 Score = 66.2 bits (160), Expect = 1e-08 Identities = 36/108 (33%), Positives = 60/108 (55%), Gaps = 5/108 (4%) Frame = +1 Query: 1 RGLFPSKVSYERLLKSLCFSCSSDLAFKIFEEMLFHDYVPCNHNCNLLLSTLCQGNTLNE 180 +GL P+ V++ L+ C + DLA +I+++ML +P N L+ LC+ LN+ Sbjct: 241 KGLVPNGVTFTTLIDGHCKNGRVDLAMEIYKQMLSQSLLPDLITYNTLIYGLCKKGDLNQ 300 Query: 181 AYEVYDMIFKRGKTPDKEIKRLLVEACYKQGDYDLAI-----MLEENI 309 A+++ D + +G PDK L++ C K+GD D A M++ENI Sbjct: 301 AHDLIDEMSMKGLKPDKITYTTLIDGCCKEGDLDTAFEHRKRMIQENI 348 >gb|ACU25582.1| pentatricopeptide repeat-containing protein [Phyla dulcis] Length = 418 Score = 66.2 bits (160), Expect = 1e-08 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 5/108 (4%) Frame = +1 Query: 1 RGLFPSKVSYERLLKSLCFSCSSDLAFKIFEEMLFHDYVPCNHNCNLLLSTLCQGNTLNE 180 +GL P+ V++ L+ C + DLA +++++ML +P N L+ LC+ LN+ Sbjct: 235 KGLVPNGVTFTTLIDGHCKNGRVDLAMEVYKQMLSQSLLPDLITYNTLIYGLCKKGALNQ 294 Query: 181 AYEVYDMIFKRGKTPDKEIKRLLVEACYKQGDYDLAI-----MLEENI 309 A+++ D + +G PDK L++ C K+GD D A M++ENI Sbjct: 295 AHDLMDEMSMKGLKPDKITYTTLIDGCCKEGDLDTAFEHRKRMIQENI 342 >ref|XP_006384788.1| hypothetical protein POPTR_0004s21110g [Populus trichocarpa] gi|550341556|gb|ERP62585.1| hypothetical protein POPTR_0004s21110g [Populus trichocarpa] Length = 1025 Score = 65.5 bits (158), Expect = 2e-08 Identities = 33/79 (41%), Positives = 49/79 (62%) Frame = +1 Query: 1 RGLFPSKVSYERLLKSLCFSCSSDLAFKIFEEMLFHDYVPCNHNCNLLLSTLCQGNTLNE 180 RG FP++++YE+ C S AF+IFEEM+ + VP + NLLL LC+ L+E Sbjct: 874 RGFFPNRLAYEKSHHYFCAGHMSIPAFRIFEEMVACNLVPGLYRRNLLLYILCEEKKLHE 933 Query: 181 AYEVYDMIFKRGKTPDKEI 237 AY D++F+RG PD+ + Sbjct: 934 AYRASDVMFERGFLPDESV 952 >gb|AFV61049.1| pentatricopeptide repeat-containing protein 11, partial [Lippia rehmannii] Length = 420 Score = 64.7 bits (156), Expect = 3e-08 Identities = 36/108 (33%), Positives = 59/108 (54%), Gaps = 5/108 (4%) Frame = +1 Query: 1 RGLFPSKVSYERLLKSLCFSCSSDLAFKIFEEMLFHDYVPCNHNCNLLLSTLCQGNTLNE 180 +GL P+ V++ L+ C + DLA +I+++ML +P N L+ LC+ LN+ Sbjct: 230 KGLVPNXVTFTTLIDGHCKNGRVDLAMEIYKQMLSQXLLPDJITYNTLVYGLCKKGDLNQ 289 Query: 181 AYEVYDMIFKRGKTPDKEIKRLLVEACYKQGDYDLAI-----MLEENI 309 A+ + D + +G PDK L++ C K+GD D A M++ENI Sbjct: 290 AHGLIDEMXXKGLKPDKFTYTTLIDGCCKEGDLDAAFEHRKRMIQENI 337 >gb|AFV61035.1| pentatricopeptide repeat-containing protein 11, partial [Lippia alba] Length = 413 Score = 64.7 bits (156), Expect = 3e-08 Identities = 36/108 (33%), Positives = 59/108 (54%), Gaps = 5/108 (4%) Frame = +1 Query: 1 RGLFPSKVSYERLLKSLCFSCSSDLAFKIFEEMLFHDYVPCNHNCNLLLSTLCQGNTLNE 180 +GL P+ V++ L+ C + DLA +I+++ML +P N L+ LC+ LN+ Sbjct: 223 KGLVPNGVTFTTLIDGHCKNGRVDLAMEIYKQMLSQSLLPDLITYNTLIYGLCKKGDLNQ 282 Query: 181 AYEVYDMIFKRGKTPDKEIKRLLVEACYKQGDYDLAI-----MLEENI 309 A+ + D + +G PDK L++ C K+GD D A M++ENI Sbjct: 283 AHGLIDEMSMKGLKPDKFTYTTLIDGCCKEGDLDAAFEHRKRMIQENI 330 >gb|AFV61054.1| pentatricopeptide repeat-containing protein 11, partial [Lippia turbinata] Length = 413 Score = 64.3 bits (155), Expect = 4e-08 Identities = 35/108 (32%), Positives = 58/108 (53%), Gaps = 5/108 (4%) Frame = +1 Query: 1 RGLFPSKVSYERLLKSLCFSCSSDLAFKIFEEMLFHDYVPCNHNCNLLLSTLCQGNTLNE 180 +GL P+ V++ L+ C + DLA +I++ ML +P N L+ LC+ L + Sbjct: 223 KGLIPNGVTFTTLIDGHCKNGRVDLAMEIYKRMLSQSLLPDLITYNTLIYGLCKNGDLKQ 282 Query: 181 AYEVYDMIFKRGKTPDKEIKRLLVEACYKQGDYDLAI-----MLEENI 309 A+++ D + +G PDK L++ C K+GD D A M++ENI Sbjct: 283 AHDLIDEMSMKGLKPDKFTYTTLIDGCCKEGDLDTAFKHRKRMIQENI 330 >gb|AFV61053.1| pentatricopeptide repeat-containing protein 11, partial [Lippia salviifolia] Length = 431 Score = 64.3 bits (155), Expect = 4e-08 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 5/108 (4%) Frame = +1 Query: 1 RGLFPSKVSYERLLKSLCFSCSSDLAFKIFEEMLFHDYVPCNHNCNLLLSTLCQGNTLNE 180 +GL P+ V++ L+ C + DLA +I+++ML +P N L+ LC+ L + Sbjct: 241 KGLVPNGVTFTTLIDGHCKNGRVDLAMEIYKQMLSQSLLPDLITYNTLIYGLCKKGDLKQ 300 Query: 181 AYEVYDMIFKRGKTPDKEIKRLLVEACYKQGDYDLAI-----MLEENI 309 A+++ D + ++G PDK L++ C K+GD D A M++ENI Sbjct: 301 AHDLIDDMSRKGLKPDKITYTTLIDGCCKEGDLDSAFEHRKRMIQENI 348 >gb|AFV61025.1| pentatricopeptide repeat-containing protein 11, partial [Lantana cujabensis] Length = 409 Score = 64.3 bits (155), Expect = 4e-08 Identities = 35/108 (32%), Positives = 59/108 (54%), Gaps = 5/108 (4%) Frame = +1 Query: 1 RGLFPSKVSYERLLKSLCFSCSSDLAFKIFEEMLFHDYVPCNHNCNLLLSTLCQGNTLNE 180 +GL P+ V++ L+ C + DLA +I+++ML +P N L+ LC+ L + Sbjct: 237 KGLVPNXVTFTTLIDGHCKNGRVDLAMEIYKQMLSQSLLPDLITYNTLIYGLCKKGDLKQ 296 Query: 181 AYEVYDMIFKRGKTPDKEIKRLLVEACYKQGDYDLAI-----MLEENI 309 A+++ D + +G PDK L++ C K+GD D A M++ENI Sbjct: 297 AHDLIDEMSXKGLKPDKFTYTTLIDGCCKEGDLDTAFXHRKRMIQENI 344