BLASTX nr result
ID: Sinomenium21_contig00032094
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00032094 (400 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511505.1| pentatricopeptide repeat-containing protein,... 67 3e-09 >ref|XP_002511505.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550620|gb|EEF52107.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 876 Score = 66.6 bits (161), Expect = 3e-09 Identities = 47/122 (38%), Positives = 61/122 (50%), Gaps = 5/122 (4%) Frame = +3 Query: 42 CTSSEDETYVPRTQQKNNEHLLPWKASAFVSKASAR-KGAIFSGDVIGTSVYDKVEGGVC 218 CT SEDE+ +PR QQ N +L + A V KASAR GD V KVE C Sbjct: 32 CTCSEDESCLPRRQQTRNNAVLAQRGPALVPKASARVSQTSLLGDAGKLLVPHKVESVEC 91 Query: 219 PASVAHVLSAPVS*HRSDGVIVNGDVHDTQKDLGYSQAIVGNHFVKTIIAP----SDFVR 386 P ++ V+SAP+S +SD V + + D+ YS + + F K IA SD V Sbjct: 92 P-TLPQVVSAPISIRKSDCVSYASGIDAVENDIPYSSPPISDQFFKAGIAAVSFLSDLVN 150 Query: 387 YK 392 YK Sbjct: 151 YK 152