BLASTX nr result
ID: Sinomenium21_contig00032040
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00032040 (563 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007024620.1| Uncharacterized protein TCM_029129 [Theobrom... 59 1e-06 ref|XP_002304137.1| proline-rich family protein [Populus trichoc... 55 1e-05 >ref|XP_007024620.1| Uncharacterized protein TCM_029129 [Theobroma cacao] gi|508779986|gb|EOY27242.1| Uncharacterized protein TCM_029129 [Theobroma cacao] Length = 188 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = +1 Query: 121 PPVHKVKERKINMGKKIGLLFVGITIILQGVVVGFLVYTRWRILKIK 261 PP H ++ K+N+GKKIGLLF GI IILQ VVGFLV+ R ++LK+K Sbjct: 133 PPPHS-RDHKVNIGKKIGLLFTGIVIILQVGVVGFLVFKRRQLLKVK 178 >ref|XP_002304137.1| proline-rich family protein [Populus trichocarpa] gi|222841569|gb|EEE79116.1| proline-rich family protein [Populus trichocarpa] Length = 167 Score = 55.5 bits (132), Expect = 1e-05 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = +1 Query: 121 PPVHKVKERKINMGKKIGLLFVGITIILQGVVVGFLVYTRWRILKIKNR 267 PP K ++N GKKIGLLFVGI ILQ VVGFL Y R ++LKI +R Sbjct: 113 PPPPPSKNHQMNSGKKIGLLFVGIAAILQIGVVGFLAYKRRQLLKINDR 161