BLASTX nr result
ID: Sinomenium21_contig00032030
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00032030 (744 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277768.1| PREDICTED: alpha-ketoglutarate-dependent dio... 65 2e-08 emb|CAN72697.1| hypothetical protein VITISV_011566 [Vitis vinifera] 65 2e-08 ref|XP_006848341.1| hypothetical protein AMTR_s00013p00177390 [A... 63 9e-08 gb|EYU25889.1| hypothetical protein MIMGU_mgv1a008280mg [Mimulus... 60 1e-06 ref|XP_006338867.1| PREDICTED: alpha-ketoglutarate-dependent dio... 57 5e-06 ref|XP_007222157.1| hypothetical protein PRUPE_ppa007688mg [Prun... 57 9e-06 >ref|XP_002277768.1| PREDICTED: alpha-ketoglutarate-dependent dioxygenase alkB [Vitis vinifera] gi|297738457|emb|CBI27658.3| unnamed protein product [Vitis vinifera] Length = 360 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -2 Query: 740 SEVFDFKAILESYNRNGETPAGIFRHRCDFDRPVFCFEDRP 618 SEV DFKAIL S+N++GE P G F +CDFDRPVFC E+RP Sbjct: 45 SEVVDFKAILRSFNQSGEVPPGTFALQCDFDRPVFCIENRP 85 >emb|CAN72697.1| hypothetical protein VITISV_011566 [Vitis vinifera] Length = 366 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -2 Query: 740 SEVFDFKAILESYNRNGETPAGIFRHRCDFDRPVFCFEDRP 618 SEV DFKAIL S+N++GE P G F +CDFDRPVFC E+RP Sbjct: 51 SEVVDFKAILRSFNQSGEVPPGTFALQCDFDRPVFCIENRP 91 >ref|XP_006848341.1| hypothetical protein AMTR_s00013p00177390 [Amborella trichopoda] gi|548851647|gb|ERN09922.1| hypothetical protein AMTR_s00013p00177390 [Amborella trichopoda] Length = 331 Score = 63.2 bits (152), Expect = 9e-08 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -2 Query: 740 SEVFDFKAILESYNRNGETPAGIFRHRCDFDRPVFCFEDRP 618 SEV DF+AIL S+ +NG TP GIF+ DFDRPVFCFE+RP Sbjct: 16 SEVLDFRAILHSFVQNGTTPPGIFKLNRDFDRPVFCFEERP 56 >gb|EYU25889.1| hypothetical protein MIMGU_mgv1a008280mg [Mimulus guttatus] Length = 379 Score = 59.7 bits (143), Expect = 1e-06 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = -2 Query: 740 SEVFDFKAILESYNRNGETPAGIFRHRCDFDRPVFCFEDRP 618 SEV DFK+ILE YN NGE G+ +CDFDRP+FC E RP Sbjct: 72 SEVVDFKSILEKYNCNGELVEGVSVLKCDFDRPIFCLESRP 112 >ref|XP_006338867.1| PREDICTED: alpha-ketoglutarate-dependent dioxygenase alkB-like isoform X1 [Solanum tuberosum] Length = 354 Score = 57.4 bits (137), Expect = 5e-06 Identities = 24/41 (58%), Positives = 30/41 (73%) Frame = -2 Query: 740 SEVFDFKAILESYNRNGETPAGIFRHRCDFDRPVFCFEDRP 618 S+V DFK+I ESY+RNGE P+GIF +CD P+FC E P Sbjct: 39 SDVIDFKSISESYHRNGELPSGIFPIQCDLHTPIFCLETHP 79 >ref|XP_007222157.1| hypothetical protein PRUPE_ppa007688mg [Prunus persica] gi|462419093|gb|EMJ23356.1| hypothetical protein PRUPE_ppa007688mg [Prunus persica] Length = 359 Score = 56.6 bits (135), Expect = 9e-06 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = -2 Query: 740 SEVFDFKAILESYNRNGETPAGIFRHRCDFDRPVFCFEDRP 618 SEV DF +ILESY +N E P G+ RCDFDRPVF E+RP Sbjct: 48 SEVLDFNSILESYYQNVELPHGVVPLRCDFDRPVFSLENRP 88