BLASTX nr result
ID: Sinomenium21_contig00031821
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00031821 (336 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003555259.1| PREDICTED: putative zinc finger protein At1g... 67 3e-09 ref|XP_007142973.1| hypothetical protein PHAVU_007G033100g [Phas... 65 1e-08 ref|XP_004300953.1| PREDICTED: putative zinc finger protein At1g... 64 3e-08 ref|XP_007044187.1| B-box zinc finger family protein, putative i... 63 5e-08 ref|XP_007044186.1| B-box zinc finger family protein, putative i... 63 5e-08 ref|XP_007044185.1| B-box zinc finger family protein, putative i... 63 5e-08 gb|EXB89375.1| Putative zinc finger protein [Morus notabilis] 62 6e-08 ref|XP_003535713.1| PREDICTED: putative zinc finger protein At1g... 62 8e-08 ref|XP_007226640.1| hypothetical protein PRUPE_ppa022195mg [Prun... 58 2e-06 ref|XP_002311478.2| hypothetical protein POPTR_0008s12410g, part... 56 5e-06 >ref|XP_003555259.1| PREDICTED: putative zinc finger protein At1g68190-like [Glycine max] Length = 438 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/57 (57%), Positives = 39/57 (68%) Frame = +1 Query: 61 DLTFQNFEELFSGDQDQNRSLFDDIDMACLSIEKDAPLNKWDNENAKKTEDISVAAS 231 DLTFQNFEELF GDQD R L DD D++C S+EKD + K D +N E+ S AAS Sbjct: 312 DLTFQNFEELFGGDQDSIRILLDDQDVSCSSLEKDKSVGKSDIDNPSAMEESSAAAS 368 >ref|XP_007142973.1| hypothetical protein PHAVU_007G033100g [Phaseolus vulgaris] gi|593625645|ref|XP_007142974.1| hypothetical protein PHAVU_007G033100g [Phaseolus vulgaris] gi|561016163|gb|ESW14967.1| hypothetical protein PHAVU_007G033100g [Phaseolus vulgaris] gi|561016164|gb|ESW14968.1| hypothetical protein PHAVU_007G033100g [Phaseolus vulgaris] Length = 437 Score = 64.7 bits (156), Expect = 1e-08 Identities = 37/78 (47%), Positives = 47/78 (60%) Frame = +1 Query: 61 DLTFQNFEELFSGDQDQNRSLFDDIDMACLSIEKDAPLNKWDNENAKKTEDISVAASAYA 240 D TFQNF+ELF GDQD R LFDD D++C S+EKD ++K D N ED AAS Sbjct: 311 DSTFQNFDELFGGDQDPIRILFDDQDVSCSSLEKDKSVDKSDIYNPSAMEDSLGAASITL 370 Query: 241 TRNFSGSVVDACPLQPAC 294 +++ G+ D PL C Sbjct: 371 SQSDHGN-KDMNPLSQYC 387 >ref|XP_004300953.1| PREDICTED: putative zinc finger protein At1g68190-like [Fragaria vesca subsp. vesca] Length = 471 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/62 (50%), Positives = 44/62 (70%) Frame = +1 Query: 61 DLTFQNFEELFSGDQDQNRSLFDDIDMACLSIEKDAPLNKWDNENAKKTEDISVAASAYA 240 DLTF+NFEE+F GDQD R L DD D++ S+E++ L+K D+ N++ D SVA+S Y Sbjct: 303 DLTFRNFEEIFGGDQDPTRVLHDDKDVSYSSVERNMSLDKSDDCNSRVMVDASVASSMYL 362 Query: 241 TR 246 T+ Sbjct: 363 TQ 364 >ref|XP_007044187.1| B-box zinc finger family protein, putative isoform 3 [Theobroma cacao] gi|508708122|gb|EOY00019.1| B-box zinc finger family protein, putative isoform 3 [Theobroma cacao] Length = 470 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/63 (47%), Positives = 41/63 (65%) Frame = +1 Query: 61 DLTFQNFEELFSGDQDQNRSLFDDIDMACLSIEKDAPLNKWDNENAKKTEDISVAASAYA 240 +LTF NFE+LF DQD R+L + D+ C S++KD NK D NA+ ED SVA+S Y Sbjct: 316 ELTFPNFEDLFGADQDPIRALLGNKDVCCSSVDKDMSFNKSDIVNARPVEDASVASSIYI 375 Query: 241 TRN 249 ++ Sbjct: 376 NQS 378 >ref|XP_007044186.1| B-box zinc finger family protein, putative isoform 2 [Theobroma cacao] gi|508708121|gb|EOY00018.1| B-box zinc finger family protein, putative isoform 2 [Theobroma cacao] Length = 511 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/63 (47%), Positives = 41/63 (65%) Frame = +1 Query: 61 DLTFQNFEELFSGDQDQNRSLFDDIDMACLSIEKDAPLNKWDNENAKKTEDISVAASAYA 240 +LTF NFE+LF DQD R+L + D+ C S++KD NK D NA+ ED SVA+S Y Sbjct: 316 ELTFPNFEDLFGADQDPIRALLGNKDVCCSSVDKDMSFNKSDIVNARPVEDASVASSIYI 375 Query: 241 TRN 249 ++ Sbjct: 376 NQS 378 >ref|XP_007044185.1| B-box zinc finger family protein, putative isoform 1 [Theobroma cacao] gi|508708120|gb|EOY00017.1| B-box zinc finger family protein, putative isoform 1 [Theobroma cacao] Length = 475 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/63 (47%), Positives = 41/63 (65%) Frame = +1 Query: 61 DLTFQNFEELFSGDQDQNRSLFDDIDMACLSIEKDAPLNKWDNENAKKTEDISVAASAYA 240 +LTF NFE+LF DQD R+L + D+ C S++KD NK D NA+ ED SVA+S Y Sbjct: 316 ELTFPNFEDLFGADQDPIRALLGNKDVCCSSVDKDMSFNKSDIVNARPVEDASVASSIYI 375 Query: 241 TRN 249 ++ Sbjct: 376 NQS 378 >gb|EXB89375.1| Putative zinc finger protein [Morus notabilis] Length = 496 Score = 62.4 bits (150), Expect = 6e-08 Identities = 35/69 (50%), Positives = 47/69 (68%), Gaps = 2/69 (2%) Frame = +1 Query: 61 DLTFQNFEELFSGDQDQNRSLFDD-IDMACLSIEKDAPLNKWDNENAKKTEDISVAAS-A 234 DLTF+NFEELF GDQD RSL DD DM+ S++KD L K DN ++ ED S+A++ + Sbjct: 303 DLTFRNFEELFGGDQDPMRSLLDDNKDMSYSSMDKDLSLEKLDNTQSRAMEDASMASTVS 362 Query: 235 YATRNFSGS 261 + R+ S S Sbjct: 363 HMDRDVSSS 371 >ref|XP_003535713.1| PREDICTED: putative zinc finger protein At1g68190-like isoform X1 [Glycine max] gi|571484830|ref|XP_006589664.1| PREDICTED: putative zinc finger protein At1g68190-like isoform X2 [Glycine max] Length = 438 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/57 (54%), Positives = 39/57 (68%) Frame = +1 Query: 61 DLTFQNFEELFSGDQDQNRSLFDDIDMACLSIEKDAPLNKWDNENAKKTEDISVAAS 231 DLTFQN+EELF GDQD R L DD D++C S+EKD ++K +N E+ S AAS Sbjct: 312 DLTFQNYEELFGGDQDPIRILLDDQDVSCSSLEKDKSVDKSVIDNPSAMEESSAAAS 368 >ref|XP_007226640.1| hypothetical protein PRUPE_ppa022195mg [Prunus persica] gi|462423576|gb|EMJ27839.1| hypothetical protein PRUPE_ppa022195mg [Prunus persica] Length = 460 Score = 57.8 bits (138), Expect = 2e-06 Identities = 35/82 (42%), Positives = 47/82 (57%), Gaps = 5/82 (6%) Frame = +1 Query: 61 DLTFQNFEELFSGDQDQNRSLFDDIDMACLSIEKDAPLNKWDN--ENAKKTEDISVAASA 234 D+TFQNFEELF DQD R+L DD D+ S+ K L+K DN A+ D S +S Sbjct: 315 DMTFQNFEELFGSDQDPTRALLDDKDVPYSSVLKYISLDKSDNGHARARMEHDASEVSSI 374 Query: 235 Y--ATRNFSGSV-VDACPLQPA 291 + +N GS+ CP+QP+ Sbjct: 375 FFNKVQNLEGSMDYCPCPIQPS 396 >ref|XP_002311478.2| hypothetical protein POPTR_0008s12410g, partial [Populus trichocarpa] gi|550332915|gb|EEE88845.2| hypothetical protein POPTR_0008s12410g, partial [Populus trichocarpa] Length = 466 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/59 (45%), Positives = 35/59 (59%) Frame = +1 Query: 61 DLTFQNFEELFSGDQDQNRSLFDDIDMACLSIEKDAPLNKWDNENAKKTEDISVAASAY 237 D TF NFEE F GDQD + D+ D +C IEKD P K +N + + +D SV +S Y Sbjct: 321 DKTFCNFEEFFGGDQDPIGAFLDENDFSCSFIEKDMPPEKSNNSDGRARKDASVTSSVY 379