BLASTX nr result
ID: Sinomenium21_contig00031666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00031666 (385 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB80244.1| hypothetical protein L484_025093 [Morus notabilis] 67 3e-09 gb|EXB32136.1| hypothetical protein L484_004150 [Morus notabilis] 57 3e-06 gb|EXC11724.1| hypothetical protein L484_020777 [Morus notabilis] 55 8e-06 >gb|EXB80244.1| hypothetical protein L484_025093 [Morus notabilis] Length = 527 Score = 66.6 bits (161), Expect = 3e-09 Identities = 34/116 (29%), Positives = 56/116 (48%), Gaps = 3/116 (2%) Frame = -3 Query: 341 WGRVAVIYKKKASVSREFLQDEIAKLIRRQVMINEISADIGIFWCNSGEEKRHVFDKEEG 162 W R V Y+ + +++ + R+V ++ + AD I WC S E+ + +EG Sbjct: 162 WERAVVAYRDWMEEGWTEISKGLSEKLERKVRVSPLFADRAILWCQSDYERDTLV--KEG 219 Query: 161 K---ENQRQFHLRDWSQDCYWCNTKIHSANRWVILEGLPLNMWNIHVFKVLRERCG 3 NQ ++ W + +W N KI W+ +E LPL+MWN H F V+ + G Sbjct: 220 SVHIRNQHAITIKRWCIETHWKNVKIEGRASWIGIEVLPLHMWNSHTFNVIGNKLG 275 >gb|EXB32136.1| hypothetical protein L484_004150 [Morus notabilis] Length = 201 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/45 (46%), Positives = 30/45 (66%) Frame = -3 Query: 137 LRDWSQDCYWCNTKIHSANRWVILEGLPLNMWNIHVFKVLRERCG 3 + WS +W + KI + N W+ +EGLPLN+WN H FK++ E CG Sbjct: 112 MEPWSIFSHWEHVKIEARNSWIGIEGLPLNLWNAHAFKIIGEACG 156 >gb|EXC11724.1| hypothetical protein L484_020777 [Morus notabilis] Length = 203 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/45 (46%), Positives = 29/45 (64%) Frame = -3 Query: 137 LRDWSQDCYWCNTKIHSANRWVILEGLPLNMWNIHVFKVLRERCG 3 + WS W + KI + N W+ +EGLPLN+WN H FK++ E CG Sbjct: 1 MEPWSIFSPWEHVKIEARNSWIRIEGLPLNLWNAHAFKIIGEACG 45